Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|028350
Gene name
Locationscaffold_12a:62603..63853
Strand-
Gene length (bp)1250
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12849 PBP_like_2 PBP superfamily domain 2.1E-08 61 264

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999706

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup9571
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|028350 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|028350

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|028350
MKTTLRFYALLAVLSAPLAVVQAQSSTSDSLLPAAVYNGGHNGTTKVGLRIANGGAGQSGLIGAWGDAFINYMVG
KGHEPFTVEWYLGDTTQSIEYLEKGQVDVAVTYNEAAERQVYDSELVSAWLYGFHDHFYFVGPPSNPAQLSTNDS
ILAMARRIVQVGNQQAAVPPTNGTVTRFLSRYDKSATNIKESEIFIKIGQVPWAYAYSKWYHQYPRFPIQALEAA
SLLSEYTLTDRGTWLSSSPDVRSRLTIFKAGTDNETDILLNPARVLIAKEDNLVDKEIGQAFGEWVVLYDEQNKT
GGQNVIETFTGTGQTGETKEPLYTRAPVNWSPANSTAGQ*
Coding >AgabiH39|028350
ATGAAAACCACACTCAGGTTTTATGCATTGCTAGCGGTCCTCTCTGCCCCCCTTGCTGTGGTTCAAGCCCAGTCT
AGTACTTCTGACTCTTTGTTGCCTGCAGCTGTCTATAATGGCGGTCATAATGGTACAACAAAAGTTGGTCTACGT
ATTGCTAACGGAGGCGCTGGACAGTCGGGGCTAATTGGCGCCTGGGGCGACGCGTTTATCAACTACATGGTCGGT
AAAGGCCATGAACCTTTTACCGTGGAGTGGTATCTGGGCGATACGACCCAGAGTATTGAGTATTTGGAGAAAGGT
CAGGTAGATGTTGCTGTGACCTACAATGAGGCTGCGGAACGGCAGGTCTACGATTCTGAGCTGGTGTCCGCTTGG
CTCTACGGTTTTCATGATCATTTCTATTTTGTCGGACCTCCGAGTAACCCAGCCCAACTTTCCACCAACGATTCT
ATTCTTGCCATGGCGCGTAGGATCGTCCAGGTCGGAAATCAACAAGCTGCAGTCCCACCAACCAATGGCACTGTC
ACCCGTTTTCTTTCTCGGTATGACAAAAGTGCCACGAACATTAAGGAAAGCGAGATTTTCATCAAGATCGGCCAA
GTTCCATGGGCTTATGCCTACTCGAAATGGTACCATCAATACCCGCGTTTCCCCATTCAAGCACTTGAAGCTGCC
TCCCTTCTGAGTGAATATACGCTCACCGACCGTGGAACATGGCTATCGAGTTCCCCAGACGTTCGATCGAGGTTG
ACGATTTTCAAAGCCGGAACTGATAACGAGACGGATATATTATTGAATCCCGCTCGCGTTTTGATCGCCAAAGAA
GACAATCTGGTTGATAAAGAAATTGGTCAAGCTTTTGGTGAATGGGTGGTTTTGTATGATGAACAGAACAAGACT
GGTGGGCAGAATGTGATTGAGACTTTCACGGGAACTGGACAGACTGGAGAAACGAAGGAGCCTTTGTATACCCGC
GCACCAGTGAACTGGTCTCCTGCCAATTCGACAGCTGGCCAGTAG
Transcript >AgabiH39|028350
ATGAAAACCACACTCAGGTTTTATGCATTGCTAGCGGTCCTCTCTGCCCCCCTTGCTGTGGTTCAAGCCCAGTCT
AGTACTTCTGACTCTTTGTTGCCTGCAGCTGTCTATAATGGCGGTCATAATGGTACAACAAAAGTTGGTCTACGT
ATTGCTAACGGAGGCGCTGGACAGTCGGGGCTAATTGGCGCCTGGGGCGACGCGTTTATCAACTACATGGTCGGT
AAAGGCCATGAACCTTTTACCGTGGAGTGGTATCTGGGCGATACGACCCAGAGTATTGAGTATTTGGAGAAAGGT
CAGGTAGATGTTGCTGTGACCTACAATGAGGCTGCGGAACGGCAGGTCTACGATTCTGAGCTGGTGTCCGCTTGG
CTCTACGGTTTTCATGATCATTTCTATTTTGTCGGACCTCCGAGTAACCCAGCCCAACTTTCCACCAACGATTCT
ATTCTTGCCATGGCGCGTAGGATCGTCCAGGTCGGAAATCAACAAGCTGCAGTCCCACCAACCAATGGCACTGTC
ACCCGTTTTCTTTCTCGGTATGACAAAAGTGCCACGAACATTAAGGAAAGCGAGATTTTCATCAAGATCGGCCAA
GTTCCATGGGCTTATGCCTACTCGAAATGGTACCATCAATACCCGCGTTTCCCCATTCAAGCACTTGAAGCTGCC
TCCCTTCTGAGTGAATATACGCTCACCGACCGTGGAACATGGCTATCGAGTTCCCCAGACGTTCGATCGAGGTTG
ACGATTTTCAAAGCCGGAACTGATAACGAGACGGATATATTATTGAATCCCGCTCGCGTTTTGATCGCCAAAGAA
GACAATCTGGTTGATAAAGAAATTGGTCAAGCTTTTGGTGAATGGGTGGTTTTGTATGATGAACAGAACAAGACT
GGTGGGCAGAATGTGATTGAGACTTTCACGGGAACTGGACAGACTGGAGAAACGAAGGAGCCTTTGTATACCCGC
GCACCAGTGAACTGGTCTCCTGCCAATTCGACAGCTGGCCAGTAG
Gene >AgabiH39|028350
ATGAAAACCACACTCAGGTTTTATGCATTGCTAGCGGTCCTCTCTGCCCCCCTTGCTGTGGTTCAAGCCCAGTCT
AGTACTTCTGACTCTTTGTTGCCTGCAGCTGTCTATAATGGCGGTCATAATGGTACAACAAAAGTTGGTCTACGT
ATTGCTAACGGAGGCGCTGGACAGTCGGGGCTAATTGGCGCCTGGGGCGACGCGTTTATCAACTACATGGTCGGT
AAAGGCCATGAACCTTTTACCGTGAGTCTATCCGTTAGGTTTATTAAGACTGTTAATGACAATTGCTGTTAGGTG
GAGTGGTATCTGGGCGATACGACCCAGAGTATTGAGTATTTGGAGAAAGGTCAGGTAGATGTTGCTGTGACCTAC
AATGAGGCTGCGGAACGGCAGGTCTACGATTCTGAGCTGGTGTCCGCTTGGCTCTACGGTTTTCATGTGAGTACT
AGTACTGGGGTCATATTTGACATCACATTTTGACGTTCTACGTCTAGGATCATTTCTATTTTGTCGGACCTCCGA
GTAACCCAGCCCAACTTTCCACCAACGATTCTATTCTTGCCATGGCGCGTAGGATCGTCCAGGTCGGAAATCAAC
AAGCTGCAGTAAGATACTTTTTCCATGAATATATGAAATTTAAACTTATGCTATTCGAACTCGCGTTAGGTCCCA
CCAACCAATGGCACTGTCACCCGTTTTCTTTCTCGGTATGACAAAAGTGCCACGAACATTAAGGAAAGCGAGATT
TTCATCAAGATCGGCCAAGTGAGTTTTCCAAAAAGAACTATGGGATGTCAAAATGGCTGACATTCTTCCTTGGAC
CTTAGGTTCCATGGGCTTATGCCTACTCGAAATGGTACCATCAATACCCGCGTTTCCCCATTCAAGCACTTGAAG
CTGCCTCCCTTCTGAGTGAATATACGCTCACCGACCGTGGAACATGGCTATCGAGTTCCCCAGACGTTCGATCGA
GGTTGACGATTTTCAAAGCCGGAACTGATAACGAGACGGATATATTATTGAATCCCGCTCGCGTTTTGATCGCCA
AAGAAGACAATCTGGTTGATAAAGAAATTGGTCAAGCTTTTGGTGAATGGGTGGTTTTGTATGATGAACAGAACA
AGACTGGTGGGCAGAATGTGATTGAGACTTTCACGGGAACTGGACAGACTGGAGAAACGAAGGAGCCTTTGTATA
CCCGCGCACCAGTGAACTGGTCTCCTGCCAATTCGACAGCTGGCCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail