Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|024700
Gene name
Locationscaffold_11a:839038..840129
Strand-
Gene length (bp)1091
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 2.5E-11 11 223

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup5616
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|024700 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|024700
Rhodonia placenta FPRL280 RhoplFPRL280|259_8

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|024700
MAIDKSIKQTYDELGYVVVPGLIPQEHWNDLDAACERVVQKTRTGTWSHRRTVGKQFPPFDNDNPDSWGVQHVMH
PQLNEPAFGKWYTSEGLLDVVKELLGCSDEQLQLELFNMLINPLSHDFALRWHRDDVNEKASEEEERNALNTWHY
GVQWNAALRPDSCLYVVPRSHSQVRTPEQRKLSETSDAPENPLDMPGAIRVTLQPGETIFYNSNILHCATYSSTS
PRVTLHGCIGDIRGGSTRARNVLQHGLEWMKGDEFRASLPQGLRARKMLDNLLDMQKNSGPVGYSLQN*
Coding >AgabiH39|024700
ATGGCCATCGACAAGTCTATCAAACAAACGTACGACGAGCTAGGCTATGTCGTTGTCCCAGGACTCATTCCCCAG
GAACACTGGAATGATCTAGATGCTGCTTGCGAGAGGGTCGTTCAGAAGACCCGTACGGGCACCTGGTCCCATCGC
AGAACCGTTGGAAAGCAATTTCCGCCATTCGATAACGACAACCCTGATTCCTGGGGTGTGCAGCATGTCATGCAC
CCGCAGCTAAATGAACCCGCTTTTGGGAAATGGTACACTTCGGAGGGTTTGCTCGACGTCGTCAAAGAACTGTTG
GGCTGCAGTGATGAGCAACTGCAGTTAGAACTCTTCAATATGCTCATCAATCCCTTAAGCCACGATTTTGCTCTC
CGCTGGCATCGCGACGATGTTAATGAGAAGGCGTCCGAGGAAGAGGAGCGCAATGCTCTGAACACTTGGCATTAT
GGAGTGCAGTGGAATGCCGCTCTTCGTCCTGATAGCTGCTTATACGTTGTTCCGCGCTCACACAGCCAAGTGAGG
ACACCGGAACAGCGTAAGCTTTCGGAAACTTCAGACGCTCCAGAGAATCCTCTGGACATGCCGGGAGCTATCCGA
GTCACTTTACAACCCGGTGAAACCATATTCTACAATTCAAACATCCTGCACTGCGCCACATACAGTTCTACTTCT
CCTCGAGTCACATTGCACGGCTGTATCGGTGACATTAGGGGTGGATCTACAAGGGCGCGTAATGTACTTCAGCAC
GGACTGGAGTGGATGAAGGGTGACGAGTTTAGGGCATCGCTTCCACAAGGTCTGAGAGCCAGAAAAATGCTTGAT
AACCTTTTGGACATGCAGAAGAACAGCGGTCCAGTCGGGTACTCTCTTCAAAATTGA
Transcript >AgabiH39|024700
ATGGCCATCGACAAGTCTATCAAACAAACGTACGACGAGCTAGGCTATGTCGTTGTCCCAGGACTCATTCCCCAG
GAACACTGGAATGATCTAGATGCTGCTTGCGAGAGGGTCGTTCAGAAGACCCGTACGGGCACCTGGTCCCATCGC
AGAACCGTTGGAAAGCAATTTCCGCCATTCGATAACGACAACCCTGATTCCTGGGGTGTGCAGCATGTCATGCAC
CCGCAGCTAAATGAACCCGCTTTTGGGAAATGGTACACTTCGGAGGGTTTGCTCGACGTCGTCAAAGAACTGTTG
GGCTGCAGTGATGAGCAACTGCAGTTAGAACTCTTCAATATGCTCATCAATCCCTTAAGCCACGATTTTGCTCTC
CGCTGGCATCGCGACGATGTTAATGAGAAGGCGTCCGAGGAAGAGGAGCGCAATGCTCTGAACACTTGGCATTAT
GGAGTGCAGTGGAATGCCGCTCTTCGTCCTGATAGCTGCTTATACGTTGTTCCGCGCTCACACAGCCAAGTGAGG
ACACCGGAACAGCGTAAGCTTTCGGAAACTTCAGACGCTCCAGAGAATCCTCTGGACATGCCGGGAGCTATCCGA
GTCACTTTACAACCCGGTGAAACCATATTCTACAATTCAAACATCCTGCACTGCGCCACATACAGTTCTACTTCT
CCTCGAGTCACATTGCACGGCTGTATCGGTGACATTAGGGGTGGATCTACAAGGGCGCGTAATGTACTTCAGCAC
GGACTGGAGTGGATGAAGGGTGACGAGTTTAGGGCATCGCTTCCACAAGGTCTGAGAGCCAGAAAAATGCTTGAT
AACCTTTTGGACATGCAGAAGAACAGCGGTCCAGTCGGGTACTCTCTTCAAAATTGA
Gene >AgabiH39|024700
ATGGCCATCGACAAGTCTATCAAACAAACGTACGACGAGCTAGGCTATGTCGTTGTCCCAGGACTCATTCCCCAG
GAACACTGGAATGATCTAGATGCTGCTTGCGAGAGGGTCGTTCAGAAGACCCGTACGGGCACCTGGTCCCATCGC
AGAACCGTTGGAAAGCAATTTCCGCCATTCGATAACGACAACCCTGATTCCTGGGGTGTGCAGCATGTCATGCAC
CCGCAGCTAAATGAACCCGCTTTTGGGAAATGGTACACTTCGGAGGGTTTGCTCGACGTCGTCAAAGAACTGTTG
GGCTGCAGTGATGAGCAACTGCAGTTAGGTTTGTCCGTTGATTGCATGAGATACCAGTGGCTAACGTATCAGAAA
AGAACTCTTCAATATGCTCATCAATCCCTTAAGCCACGATTTTGCTCTCCGCTGGCATCGCGACGATGTTAATGA
GAAGGCGTCCGAGGAAGAGGAGCGCAATGCTCTGAACACTTGGCATTATGGAGTATGTTAAACTGCATGCTAGCG
ATCTTCGGGTACTCACGACAGTCAACTCTAGGTGCAGTGGAATGCGTATGGTCAGATCTATTACTATACACTTCT
TCGCCATTGAAGTAACCTTCTAGCGCTCTTCGTCCTGATAGCTGCTTATACGTTGTTCCGCGCTCACACAGCCAA
GTGAGGACACCGGAACAGCGTAAGCTTTCGGAAACTTCAGACGCTCCAGAGAATCCTCTGGACATGCCGGGAGCT
ATCCGAGTCACTTTACAACGTGAGCAGAATCATCATTATTTCCCATCTGACGCCGCCTGATCACACTGTTAGCCG
GTGAAACCATATTCTACAATTCAAACATCCTGCACTGCGCCACATACAGTTCTACTTCTCCTCGAGTCACATTGC
ACGGCTGTATCGGTGACATTAGGGGTGGATCTACAAGGGCGCGTAATGTACTTCAGCACGGACTGGAGTGGATGA
AGGGTGACGAGTTTAGGGCATCGCTTCCACAAGGTCTGAGAGCCAGAAAAATGCTTGATAACCTTTTGGACATGC
AGAAGAACAGCGGTCCAGTCGGGTACTCTCTTCAAAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail