Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|023000
Gene name
Locationscaffold_11a:457841..459198
Strand-
Gene length (bp)1357
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 7.2E-84 4 345

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7KWM9|IUNH_DICDI Inosine-uridine-preferring nucleoside hydrolase homolog OS=Dictyostelium discoideum GN=iunH PE=3 SV=1 4 354 1.0E-56
sp|Q10314|YD62_SCHPO Uncharacterized protein C17G8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.02 PE=3 SV=1 3 352 6.0E-47
sp|B1KHA5|RIHA_SHEWM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rihA PE=3 SV=1 2 352 3.0E-42
sp|Q0HZ05|RIHA_SHESR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain MR-7) GN=rihA PE=3 SV=1 2 351 3.0E-41
sp|Q0HEZ4|RIHA_SHESM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain MR-4) GN=rihA PE=3 SV=1 2 351 7.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7KWM9|IUNH_DICDI Inosine-uridine-preferring nucleoside hydrolase homolog OS=Dictyostelium discoideum GN=iunH PE=3 SV=1 4 354 1.0E-56
sp|Q10314|YD62_SCHPO Uncharacterized protein C17G8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.02 PE=3 SV=1 3 352 6.0E-47
sp|B1KHA5|RIHA_SHEWM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rihA PE=3 SV=1 2 352 3.0E-42
sp|Q0HZ05|RIHA_SHESR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain MR-7) GN=rihA PE=3 SV=1 2 351 3.0E-41
sp|Q0HEZ4|RIHA_SHESM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain MR-4) GN=rihA PE=3 SV=1 2 351 7.0E-41
sp|A6WSI3|RIHA_SHEB8 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella baltica (strain OS185) GN=rihA PE=3 SV=1 2 355 8.0E-41
sp|A0L0Y0|RIHA_SHESA Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella sp. (strain ANA-3) GN=rihA PE=3 SV=1 2 351 2.0E-40
sp|A3D0C6|RIHA_SHEB5 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rihA PE=3 SV=1 2 355 3.0E-40
sp|B5BCD9|RIHA_SALPK Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi A (strain AKU_12601) GN=rihA PE=3 SV=1 4 352 2.0E-39
sp|Q5PM78|RIHA_SALPA Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rihA PE=3 SV=1 4 352 2.0E-39
sp|Q04179|URH1_YEAST Uridine nucleosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URH1 PE=1 SV=2 4 298 2.0E-39
sp|Q324P5|RIHA_SHIBS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella boydii serotype 4 (strain Sb227) GN=rihA PE=3 SV=1 4 349 3.0E-39
sp|Q83LY1|RIHA_SHIFL Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella flexneri GN=rihA PE=3 SV=4 4 349 4.0E-39
sp|Q0T6R1|RIHA_SHIF8 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella flexneri serotype 5b (strain 8401) GN=rihA PE=3 SV=1 4 349 4.0E-39
sp|A6T9S2|RIHA_KLEP7 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rihA PE=3 SV=1 4 347 4.0E-39
sp|P41409|RIHA_ECOLI Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain K12) GN=rihA PE=1 SV=2 4 349 4.0E-39
sp|C4ZWD8|RIHA_ECOBW Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihA PE=3 SV=1 4 349 4.0E-39
sp|A8AJF8|RIHA_CITK8 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rihA PE=3 SV=1 4 347 6.0E-39
sp|Q3Z4E1|RIHA_SHISS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella sonnei (strain Ss046) GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|B7M5H8|RIHA_ECO8A Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O8 (strain IAI1) GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|B1IYF7|RIHA_ECOLC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|B5YQK2|RIHA_ECO5E Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|Q8XBL8|RIHA_ECO57 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O157:H7 GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|B2TU69|RIHA_SHIB3 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|B7N9Q7|RIHA_ECOLU Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihA PE=3 SV=1 4 349 6.0E-39
sp|A4W829|RIHA_ENT38 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Enterobacter sp. (strain 638) GN=rihA PE=3 SV=1 4 347 6.0E-39
sp|B5EZA2|RIHA_SALA4 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella agona (strain SL483) GN=rihA PE=3 SV=1 4 352 9.0E-39
sp|B6I163|RIHA_ECOSE Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain SE11) GN=rihA PE=3 SV=1 4 349 9.0E-39
sp|B7L9J7|RIHA_ECO55 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain 55989 / EAEC) GN=rihA PE=3 SV=1 4 349 9.0E-39
sp|A7ZJ42|RIHA_ECO24 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihA PE=3 SV=1 4 349 9.0E-39
sp|Q8FJY8|RIHA_ECOL6 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihA PE=3 SV=2 4 349 1.0E-38
sp|A1A8R9|RIHA_ECOK1 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O1:K1 / APEC GN=rihA PE=3 SV=1 4 349 1.0E-38
sp|B7MFR7|RIHA_ECO45 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihA PE=3 SV=1 4 349 1.0E-38
sp|C0PW90|RIHA_SALPC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi C (strain RKS4594) GN=rihA PE=3 SV=1 4 352 1.0E-38
sp|B7NM03|RIHA_ECO7I Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihA PE=3 SV=1 4 347 1.0E-38
sp|B7UKT4|RIHA_ECO27 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihA PE=3 SV=1 4 349 2.0E-38
sp|A7ZXS0|RIHA_ECOHS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O9:H4 (strain HS) GN=rihA PE=3 SV=1 4 349 2.0E-38
sp|B5XWV7|RIHA_KLEP3 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Klebsiella pneumoniae (strain 342) GN=rihA PE=3 SV=1 6 347 3.0E-38
sp|B4TPY1|RIHA_SALSV Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella schwarzengrund (strain CVM19633) GN=rihA PE=3 SV=1 4 347 5.0E-38
sp|B7LKV4|RIHA_ESCF3 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihA PE=3 SV=1 4 347 6.0E-38
sp|Q8Z8H0|RIHA_SALTI Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella typhi GN=rihA PE=3 SV=1 4 352 7.0E-38
sp|A9MUJ0|RIHA_SALPB Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rihA PE=3 SV=1 4 352 7.0E-38
sp|Q0TK29|RIHA_ECOL5 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihA PE=3 SV=1 4 349 9.0E-38
sp|B7MRT1|RIHA_ECO81 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli O81 (strain ED1a) GN=rihA PE=3 SV=1 4 349 9.0E-38
sp|B4SYM0|RIHA_SALNS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella newport (strain SL254) GN=rihA PE=3 SV=1 4 352 1.0E-37
sp|B5FNA2|RIHA_SALDC Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella dublin (strain CT_02021853) GN=rihA PE=3 SV=1 4 352 1.0E-37
sp|B5R809|RIHA_SALG2 Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rihA PE=3 SV=1 4 352 1.0E-37
sp|Q57RR6|RIHA_SALCH Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella choleraesuis (strain SC-B67) GN=rihA PE=3 SV=1 4 352 2.0E-37
sp|B5QVR2|RIHA_SALEP Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella enteritidis PT4 (strain P125109) GN=rihA PE=3 SV=1 4 352 2.0E-37
sp|B4TB65|RIHA_SALHS Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella heidelberg (strain SL476) GN=rihA PE=3 SV=1 4 352 2.0E-37
sp|A9MKC6|RIHA_SALAR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rihA PE=3 SV=1 4 347 2.0E-37
sp|Q8EIM7|RIHA_SHEON Pyrimidine-specific ribonucleoside hydrolase RihA OS=Shewanella oneidensis (strain MR-1) GN=rihA PE=3 SV=1 4 347 9.0E-37
sp|B1LLA1|RIHA_ECOSM Pyrimidine-specific ribonucleoside hydrolase RihA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihA PE=3 SV=1 4 349 1.0E-36
sp|P83851|IUNH_LEIMA Inosine-uridine preferring nucleoside hydrolase OS=Leishmania major GN=NSNH PE=1 SV=3 2 352 4.0E-36
sp|Q8ZQY4|RIHA_SALTY Pyrimidine-specific ribonucleoside hydrolase RihA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rihA PE=3 SV=1 4 352 6.0E-36
sp|Q6LQG2|RIHA_PHOPR Pyrimidine-specific ribonucleoside hydrolase RihA OS=Photobacterium profundum GN=rihA PE=3 SV=1 2 347 3.0E-35
sp|Q9P6J4|YHD6_SCHPO Uncharacterized protein C1683.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.06c PE=3 SV=1 3 349 3.0E-34
sp|Q27546|IUNH_CRIFA Inosine-uridine preferring nucleoside hydrolase OS=Crithidia fasciculata GN=IUNH PE=1 SV=3 2 352 2.0E-32
sp|B7LVC3|RIHB_ESCF3 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|Q1R9R0|RIHB_ECOUT Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain UTI89 / UPEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|Q8FFT8|RIHB_ECOL6 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|Q0TFS8|RIHB_ECOL5 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|A1AD20|RIHB_ECOK1 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O1:K1 / APEC GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B7MX26|RIHB_ECO81 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O81 (strain ED1a) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B7MF76|RIHB_ECO45 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B7UFH8|RIHB_ECO27 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B1LKQ9|RIHB_ECOSM Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B7NMX6|RIHB_ECO7I Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B7LAI5|RIHB_ECO55 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain 55989 / EAEC) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B1IYA8|RIHB_ECOLC Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|A8A225|RIHB_ECOHS Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O9:H4 (strain HS) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|B7M510|RIHB_ECO8A Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O8 (strain IAI1) GN=rihB PE=3 SV=1 2 352 7.0E-30
sp|P33022|RIHB_ECOLI Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12) GN=rihB PE=1 SV=1 2 352 9.0E-30
sp|B1X860|RIHB_ECODH Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12 / DH10B) GN=rihB PE=3 SV=1 2 352 9.0E-30
sp|C4ZU12|RIHB_ECOBW Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihB PE=3 SV=1 2 352 9.0E-30
sp|A7ZNY5|RIHB_ECO24 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihB PE=3 SV=1 2 352 9.0E-30
sp|Q3Z044|RIHB_SHISS Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella sonnei (strain Ss046) GN=rihB PE=3 SV=1 2 352 1.0E-29
sp|Q83KF1|RIHB_SHIFL Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella flexneri GN=rihB PE=3 SV=1 2 352 2.0E-29
sp|Q0T2W2|RIHB_SHIF8 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella flexneri serotype 5b (strain 8401) GN=rihB PE=3 SV=1 2 352 2.0E-29
sp|B5YWV3|RIHB_ECO5E Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihB PE=3 SV=1 2 352 4.0E-29
sp|Q8XE94|RIHB_ECO57 Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O157:H7 GN=rihB PE=3 SV=1 2 352 4.0E-29
sp|B7N5C5|RIHB_ECOLU Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihB PE=3 SV=1 2 352 5.0E-29
sp|B6I8L3|RIHB_ECOSE Pyrimidine-specific ribonucleoside hydrolase RihB OS=Escherichia coli (strain SE11) GN=rihB PE=3 SV=1 2 352 1.0E-28
sp|B4TIF1|RIHC_SALHS Non-specific ribonucleoside hydrolase RihC OS=Salmonella heidelberg (strain SL476) GN=rihC PE=3 SV=1 3 353 7.0E-25
sp|B5RG86|RIHC_SALG2 Non-specific ribonucleoside hydrolase RihC OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|B5R1P1|RIHC_SALEP Non-specific ribonucleoside hydrolase RihC OS=Salmonella enteritidis PT4 (strain P125109) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|Q8ZRY7|RIHC_SALTY Non-specific ribonucleoside hydrolase RihC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|B4T6H8|RIHC_SALNS Non-specific ribonucleoside hydrolase RihC OS=Salmonella newport (strain SL254) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|B5FHE5|RIHC_SALDC Non-specific ribonucleoside hydrolase RihC OS=Salmonella dublin (strain CT_02021853) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|C0Q4J2|RIHC_SALPC Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi C (strain RKS4594) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|Q57TL0|RIHC_SALCH Non-specific ribonucleoside hydrolase RihC OS=Salmonella choleraesuis (strain SC-B67) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|Q8Z9M9|RIHC_SALTI Non-specific ribonucleoside hydrolase RihC OS=Salmonella typhi GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|A9MYH1|RIHC_SALPB Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rihC PE=3 SV=1 3 343 1.0E-24
sp|B5F731|RIHC_SALA4 Non-specific ribonucleoside hydrolase RihC OS=Salmonella agona (strain SL483) GN=rihC PE=3 SV=1 3 354 3.0E-24
sp|Q6ZJ05|URH1_ORYSJ Probable uridine nucleosidase 1 OS=Oryza sativa subsp. japonica GN=URH1 PE=2 SV=1 6 341 4.0E-24
sp|B5BLL5|RIHC_SALPK Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi A (strain AKU_12601) GN=rihC PE=3 SV=1 3 343 9.0E-24
sp|Q5PKI2|RIHC_SALPA Non-specific ribonucleoside hydrolase RihC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rihC PE=3 SV=1 3 343 9.0E-24
sp|Q32K67|RIHC_SHIDS Non-specific ribonucleoside hydrolase RihC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rihC PE=3 SV=1 4 343 1.0E-22
sp|Q8LAC4|URH2_ARATH Probable uridine nucleosidase 2 OS=Arabidopsis thaliana GN=URH2 PE=2 SV=1 2 349 2.0E-22
sp|B7LVN6|RIHC_ESCF3 Non-specific ribonucleoside hydrolase RihC OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rihC PE=3 SV=1 4 343 3.0E-22
sp|A6T4G4|RIHC_KLEP7 Non-specific ribonucleoside hydrolase RihC OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rihC PE=3 SV=1 4 343 3.0E-22
sp|Q9SJM7|URH1_ARATH Uridine nucleosidase 1 OS=Arabidopsis thaliana GN=URH1 PE=1 SV=2 2 325 3.0E-22
sp|B7NHD4|RIHC_ECO7I Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rihC PE=3 SV=1 4 343 4.0E-22
sp|P22564|RIHC_ECOLI Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain K12) GN=rihC PE=1 SV=1 4 343 4.0E-22
sp|B1XBF5|RIHC_ECODH Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain K12 / DH10B) GN=rihC PE=3 SV=1 4 343 4.0E-22
sp|C4ZPV6|RIHC_ECOBW Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rihC PE=3 SV=1 4 343 4.0E-22
sp|B7L4F2|RIHC_ECO55 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain 55989 / EAEC) GN=rihC PE=3 SV=1 4 343 4.0E-22
sp|B5Y231|RIHC_KLEP3 Non-specific ribonucleoside hydrolase RihC OS=Klebsiella pneumoniae (strain 342) GN=rihC PE=3 SV=1 4 343 4.0E-22
sp|B4TWP3|RIHC_SALSV Non-specific ribonucleoside hydrolase RihC OS=Salmonella schwarzengrund (strain CVM19633) GN=rihC PE=3 SV=1 3 354 4.0E-22
sp|A7ZVX8|RIHC_ECOHS Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O9:H4 (strain HS) GN=rihC PE=3 SV=1 4 343 6.0E-22
sp|B7M0C6|RIHC_ECO8A Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O8 (strain IAI1) GN=rihC PE=3 SV=1 4 343 6.0E-22
sp|P0C0W2|RIHC_ECOL6 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rihC PE=3 SV=1 4 343 6.0E-22
sp|Q3Z5Y0|RIHC_SHISS Non-specific ribonucleoside hydrolase RihC OS=Shigella sonnei (strain Ss046) GN=rihC PE=3 SV=1 4 343 1.0E-21
sp|Q326J3|RIHC_SHIBS Non-specific ribonucleoside hydrolase RihC OS=Shigella boydii serotype 4 (strain Sb227) GN=rihC PE=3 SV=1 4 343 1.0E-21
sp|A7ZHB9|RIHC_ECO24 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rihC PE=3 SV=1 4 343 1.0E-21
sp|B1LFW0|RIHC_ECOSM Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rihC PE=3 SV=1 4 343 1.0E-21
sp|B5YYC2|RIHC_ECO5E Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rihC PE=3 SV=1 4 343 2.0E-21
sp|Q8XA41|RIHC_ECO57 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O157:H7 GN=rihC PE=3 SV=1 4 343 2.0E-21
sp|B2U249|RIHC_SHIB3 Non-specific ribonucleoside hydrolase RihC OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rihC PE=3 SV=1 4 343 2.0E-21
sp|B6HYX8|RIHC_ECOSE Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain SE11) GN=rihC PE=3 SV=1 4 343 2.0E-21
sp|B7N7Q4|RIHC_ECOLU Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rihC PE=3 SV=1 4 343 2.0E-21
sp|Q1RGH2|RIHC_ECOUT Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli (strain UTI89 / UPEC) GN=rihC PE=3 SV=1 4 343 4.0E-21
sp|A1A778|RIHC_ECOK1 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O1:K1 / APEC GN=rihC PE=3 SV=1 4 343 4.0E-21
sp|B7MNN5|RIHC_ECO81 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O81 (strain ED1a) GN=rihC PE=3 SV=1 4 343 4.0E-21
sp|B7MAF0|RIHC_ECO45 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rihC PE=3 SV=1 4 343 4.0E-21
sp|Q83MH0|RIHC_SHIFL Non-specific ribonucleoside hydrolase RihC OS=Shigella flexneri GN=rihC PE=3 SV=1 4 343 1.0E-20
sp|Q0T8G4|RIHC_SHIF8 Non-specific ribonucleoside hydrolase RihC OS=Shigella flexneri serotype 5b (strain 8401) GN=rihC PE=3 SV=1 4 343 1.0E-20
sp|Q0TLW1|RIHC_ECOL5 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rihC PE=3 SV=1 4 343 1.0E-20
sp|B7UI75|RIHC_ECO27 Non-specific ribonucleoside hydrolase RihC OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rihC PE=3 SV=1 4 343 1.0E-20
sp|Q652Q8|URH2_ORYSJ Probable uridine nucleosidase 2 OS=Oryza sativa subsp. japonica GN=URH2 PE=2 SV=1 2 325 2.0E-20
sp|Q32ER0|RIHB_SHIDS Putative pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rihB PE=3 SV=1 60 352 8.0E-18
sp|Q31YW9|RIHB_SHIBS Putative pyrimidine-specific ribonucleoside hydrolase RihB OS=Shigella boydii serotype 4 (strain Sb227) GN=rihB PE=3 SV=1 137 352 7.0E-17
sp|P32986|YBP2_ACIAM Uncharacterized protein in bps2 5'region (Fragment) OS=Acidianus ambivalens PE=3 SV=1 6 194 3.0E-10
sp|Q45825|YRI3_CORAM Uncharacterized protein in ribF 3'region (Fragment) OS=Corynebacterium ammoniagenes PE=3 SV=1 1 91 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|023000
MKNIWLDVDPGHDDAIALMLAIHCSNVNLIGVSTTHGNTSSSNTALNAARCLNAFGAPEHIKVYPGATKPLILPA
KHDPEIHGEDGLGGVEGLPSVNEDPSILKRFVADEGGEQVRALEGMIKEIKKCWKNGKGEKVTLVTTGPMTNVAL
FVSCYEDFVAEGGAVEEIVFMGGGVGLGNRSAVAEYNILTDPHATQIVLDCPVKVTMIPINVTHTAIATHEIQHR
LLTNSTAPSVLAQELPPAKTRLRHTLNTIITFFASTYKSVFQFHTGPPLHDALTIAYIQNPNLFKGKRYRVDVEL
NIGGHCMGETVVDVWDYRACRENTWGREGKNCFVVQEIDVPGFFDLFFDCVECCDQISPLNQP*
Coding >AgabiH39|023000
ATGAAGAACATCTGGCTCGACGTCGATCCTGGCCATGACGACGCCATTGCGTTGATGCTGGCGATACACTGCTCG
AACGTCAATCTAATCGGGGTATCAACTACACATGGAAATACGTCAAGTTCAAATACTGCTTTAAACGCTGCTCGA
TGTCTAAATGCTTTTGGAGCTCCGGAACATATCAAGGTTTATCCAGGAGCAACTAAACCTCTTATCTTACCTGCG
AAACACGATCCAGAAATTCATGGTGAAGACGGATTAGGAGGGGTGGAAGGATTACCTAGCGTTAATGAAGATCCT
TCCATACTCAAGCGGTTTGTCGCTGATGAGGGTGGTGAACAAGTAAGGGCGTTGGAAGGTATGATTAAAGAGATT
AAAAAGTGTTGGAAGAATGGGAAAGGAGAGAAAGTGACTTTGGTTACGACGGGGCCGATGACCAATGTTGCGTTA
TTCGTTAGTTGTTATGAAGATTTTGTGGCGGAAGGAGGTGCGGTCGAGGAGATTGTGTTTATGGGTGGAGGCGTT
GGACTTGGAAATCGCTCGGCTGTGGCGGAGTATAATATTTTGACAGACCCTCATGCGACACAGATTGTATTGGAT
TGCCCGGTAAAGGTGACTATGATACCTATCAATGTCACTCATACCGCTATCGCAACACATGAAATCCAACATCGG
CTCTTGACAAATTCAACTGCTCCTAGTGTGTTAGCTCAGGAACTCCCACCTGCTAAAACTCGTCTCCGCCATACA
CTCAACACTATCATAACATTCTTCGCGTCAACTTACAAATCTGTATTCCAATTTCATACCGGACCACCACTTCAC
GACGCACTCACAATAGCTTACATTCAAAACCCAAATCTGTTTAAAGGGAAACGGTATAGGGTTGATGTGGAGTTG
AATATCGGGGGACATTGTATGGGAGAGACTGTGGTCGATGTTTGGGATTATAGAGCATGTAGAGAAAATACTTGG
GGAAGAGAAGGAAAGAACTGTTTCGTTGTTCAAGAAATTGATGTTCCAGGATTTTTTGACTTGTTCTTTGATTGT
GTGGAATGTTGTGATCAGATATCGCCTCTGAACCAACCCTGA
Transcript >AgabiH39|023000
ATGAAGAACATCTGGCTCGACGTCGATCCTGGCCATGACGACGCCATTGCGTTGATGCTGGCGATACACTGCTCG
AACGTCAATCTAATCGGGGTATCAACTACACATGGAAATACGTCAAGTTCAAATACTGCTTTAAACGCTGCTCGA
TGTCTAAATGCTTTTGGAGCTCCGGAACATATCAAGGTTTATCCAGGAGCAACTAAACCTCTTATCTTACCTGCG
AAACACGATCCAGAAATTCATGGTGAAGACGGATTAGGAGGGGTGGAAGGATTACCTAGCGTTAATGAAGATCCT
TCCATACTCAAGCGGTTTGTCGCTGATGAGGGTGGTGAACAAGTAAGGGCGTTGGAAGGTATGATTAAAGAGATT
AAAAAGTGTTGGAAGAATGGGAAAGGAGAGAAAGTGACTTTGGTTACGACGGGGCCGATGACCAATGTTGCGTTA
TTCGTTAGTTGTTATGAAGATTTTGTGGCGGAAGGAGGTGCGGTCGAGGAGATTGTGTTTATGGGTGGAGGCGTT
GGACTTGGAAATCGCTCGGCTGTGGCGGAGTATAATATTTTGACAGACCCTCATGCGACACAGATTGTATTGGAT
TGCCCGGTAAAGGTGACTATGATACCTATCAATGTCACTCATACCGCTATCGCAACACATGAAATCCAACATCGG
CTCTTGACAAATTCAACTGCTCCTAGTGTGTTAGCTCAGGAACTCCCACCTGCTAAAACTCGTCTCCGCCATACA
CTCAACACTATCATAACATTCTTCGCGTCAACTTACAAATCTGTATTCCAATTTCATACCGGACCACCACTTCAC
GACGCACTCACAATAGCTTACATTCAAAACCCAAATCTGTTTAAAGGGAAACGGTATAGGGTTGATGTGGAGTTG
AATATCGGGGGACATTGTATGGGAGAGACTGTGGTCGATGTTTGGGATTATAGAGCATGTAGAGAAAATACTTGG
GGAAGAGAAGGAAAGAACTGTTTCGTTGTTCAAGAAATTGATGTTCCAGGATTTTTTGACTTGTTCTTTGATTGT
GTGGAATGTTGTGATCAGATATCGCCTCTGAACCAACCCTGA
Gene >AgabiH39|023000
ATGAAGAACATCTGGCTCGACGTCGATCCTGTATCCTATATATCTCTTTTCCTTTTCCTTTAACGATTTCAAGCC
TTTGTTACAGGGCCATGACGACGCCATTGCGTTGATGCTGGCGATACACTGCTCGAACGTCAATCTAATCGGGGT
ATCAACTGTATGAAAAGACATTCTTCCTTCACCTTCCTTCTCGGTTAATCTGACTTTTTTTGTTCTAGACACATG
GAAATACGTCAAGTTCAAATACTGCTTTAAACGCTGCTCGATGTCTAAATGCTTTTGGAGCTCCGGAACATATCA
AGGTTTATCCAGGAGCAACTAAACCTCTTATCTTACCTGCGAAACACGATCCAGAAATTCATGGTGAAGACGGAT
TAGGAGGGGTGGAAGGATTACCTAGCGTTAATGAAGATCCTTCCATACTCAAGCGGTTTGTCGCTGATGAGGGTG
GTGAACAAGTAAGGGCGTTGGAAGGTATGATTAAAGAGATTAAAAAGTGTTGGAAGAATGGGAAAGGAGAGAAAG
TGACTTTGGTTACGACGGGGCCGATGACCAATGTTGCGTTATTCGTTAGTTGTTATGAAGATTTTGTGGCGGAAG
GAGGTGCGGTCGAGGAGATTGTGTTTATGGGTGGAGGCGTTGGACTTGGAAATCGCTCGGCTGTGGCGGAGTATA
ATATTTTGACAGACCGTTGAGCCTTTTCTTTTGCTTATTTTTGAAACTTGGTGGTACTGATATCGAGGTTATATA
GCTCATGCGACACAGATTGTATTGGATTGCCCGGTAAAGGTGACTATGATACCTATCAATGTCACTCATACCGCT
ATCGCAACACATGAAATCCAACATCGGCTCTTGACAAATTCAACTGCTCCTAGTGTGTTAGCTCAGGAACTCCCA
CCTGCTAAAACTCGTCTCCGCCATACACTCAACACTATCATAACATTCTTCGCGTCAACTTACAAATCTGTATTC
CAATTTCATACCGGACCACCACTTCACGACGCACTCACAATAGCTTACATTCAAAACCCAAATCTGTTTAAAGGG
AAACGGTATAGGGTTGATGTGGAGTTGAATATCGGGGGACATTGTATGGGAGAGACTGTGGTCGATGTTTGGGAT
TATAGAGCATGTAGAGAAAATACTTGGGGAAGAGAAGGAAAGAACTGTTTCGTTGTTCAAGAAATTGATGTGAGT
ATCGATTCCCTGGTGGTTCTTTGTAACATTTTGGCTGATTACTGTATATGAAAACATTTTGCTTTCTTTTTCTCA
CCGCAAGGTTCCAGGATTTTTTGACTTGTTCTTTGATTGTGTGGAATGTTGTGATCAGATATCGCCTCTGAACCA
ACCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail