Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|020330
Gene name
Locationscaffold_10:1402808..1407680
Strand-
Gene length (bp)4872
Transcript length (bp)4275
Coding sequence length (bp)4275
Protein length (aa) 1425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12738 PTCB-BRCT twin BRCT domain 6.8E-19 369 429
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 4.4E-10 369 433
PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain 9.9E-17 1221 1299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 41 455 3.0E-32
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 1237 1414 2.0E-24
sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 1237 1414 2.0E-24
sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 1237 1414 2.0E-23
sp|Q90WJ3|PAXI1_XENLA PAX-interacting protein 1 OS=Xenopus laevis GN=paxip1 PE=1 SV=1 1237 1414 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 41 455 3.0E-32
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 1237 1414 2.0E-24
sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 1237 1414 2.0E-24
sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 1237 1414 2.0E-23
sp|Q90WJ3|PAXI1_XENLA PAX-interacting protein 1 OS=Xenopus laevis GN=paxip1 PE=1 SV=1 1237 1414 2.0E-23
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 1215 1415 3.0E-23
sp|Q5TM68|MDC1_MACMU Mediator of DNA damage checkpoint protein 1 OS=Macaca mulatta GN=MDC1 PE=3 SV=1 1242 1409 4.0E-20
sp|Q7YR40|MDC1_PANTR Mediator of DNA damage checkpoint protein 1 OS=Pan troglodytes GN=MDC1 PE=3 SV=1 1242 1409 6.0E-20
sp|Q14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens GN=MDC1 PE=1 SV=3 1242 1409 6.0E-20
sp|Q5U2M8|MDC1_RAT Mediator of DNA damage checkpoint protein 1 OS=Rattus norvegicus GN=Mdc1 PE=1 SV=2 1242 1409 7.0E-19
sp|Q767L8|MDC1_PIG Mediator of DNA damage checkpoint protein 1 OS=Sus scrofa GN=MDC1 PE=3 SV=1 1242 1409 2.0E-18
sp|Q5PSV9|MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus GN=Mdc1 PE=1 SV=1 1242 1409 2.0E-18
sp|P38850|RT107_YEAST Regulator of Ty1 transposition protein 107 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT107 PE=1 SV=1 329 435 1.0E-11
sp|Q5XIY8|PAXI1_DANRE PAX-interacting protein 1 OS=Danio rerio GN=paxip1 PE=2 SV=1 3 168 1.0E-09
sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 306 432 2.0E-09
sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 306 432 4.0E-09
sp|Q5XIY8|PAXI1_DANRE PAX-interacting protein 1 OS=Danio rerio GN=paxip1 PE=2 SV=1 302 435 7.0E-09
sp|Q90WJ3|PAXI1_XENLA PAX-interacting protein 1 OS=Xenopus laevis GN=paxip1 PE=1 SV=1 306 435 1.0E-08
sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 3 167 1.0E-08
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 290 432 2.0E-08
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 3 167 6.0E-08
sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 3 167 4.0E-07
sp|Q90WJ3|PAXI1_XENLA PAX-interacting protein 1 OS=Xenopus laevis GN=paxip1 PE=1 SV=1 3 167 7.0E-07
sp|O04251|Y4211_ARATH BRCT domain-containing protein At4g02110 OS=Arabidopsis thaliana GN=At4g02110 PE=3 SV=3 1252 1407 7.0E-07
sp|O04251|Y4211_ARATH BRCT domain-containing protein At4g02110 OS=Arabidopsis thaliana GN=At4g02110 PE=3 SV=3 327 490 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|020330
MSLFHNTKYFLANSLPPNRQEQLEYALSKNGAIKADTLTNATHIITNSAHFEGSEYIDQGVFVVSDQWVDRSLVL
GKLQGPQYYSVDPGMIFSGIVACATEQLPTHDLEVLSAGITALGGQWRVALTSDVTHLFATSPNSPKYTTALAHR
DSAGIKILLPHWFDDSVRLGIKNLSVEPYLWPDPPLLTDIGATANIKTHNRQSSEDKAKKALLSTMNDFTPSFDS
KVPLPKDVDLMLVKKNVWNGKRILLSWTLSLYGSRREAVEAGIRRAGGMVLRYPTDDDEDLTTEAREKRRDKKEA
RAVDECDILITRWRSGRSYGRAFRLHKTIGTMAWLYHVESSGQTPRPVDQLLHYPVPRTPINNFGMHEITVTNYT
GEAREYIKKLISSMGAKFTPSMTGKNTVLIAAYIQGTKADKARAWSIPIVNHTWLEDCYIQWRHLTMATEKYIVF
PPGVDFSKLLGERGVGIRGVELCDEEEGKEGDSGSEDENAMDVDHVQDDGVWKEDEHDDLDILSMPDPDDLRELS
IPPQQAFKTPSKKSPMKSKAHGKSSSVSPSKRVISASVSPTKREVEVVITPARKGAYLDAMRITPGKSASKSKSS
SPVKRRTIVPSNERGRVGKKDATSDVDGDDEGTSRSRAQTPELAPMEVDEEGIDRDVVNVSNPPKKKPVMKPNSK
ANGSVGSKKTKKRIELIPEPEVSGESDATLNRTPATLRRLAKKTPDAAEDDIQDSNKKSSPRKRPNEDDESYHQT
TEATTATSSVISSRRLIRRLTSEASSELEKEKEREKEKMKNRSLTKLTRRATNGRIPSEESVDHELAGNEIETGD
EGEEEKENVVDVHVKSPRKSKSDAPPLPKTSLLKMTRGDARTRVKVKSAKAKARELYSSEEEVMDIVKDKPMKGK
KGKEKAKAKEEIKPKKKGRQSKVVSEDEESTHVESEEEEEVGQGGDPATKKTTLKSLKTRPSRQNLVEVVINTPM
KTPEKTQAKTYSSKSKGKKKAVAEDEENAGSSEVEKDAEETEEEKPVSRRDSLRKLKKTESIRAEAEEKAVKAST
LRPKPISLAGSTLGSKPKSKRRQSHHVSPPPDSSRTHTPVTDTNELLPAKRGAATRAQEKLKVMMPDATKFEAEL
RKARKSGGGMAGIGIGSWEQEEDSGSVIKSRNKRKSNDMDVDEEMEDGGKKRRRSSGKARAAEENEDEVVEVPLG
KKAKAKAKPSDGHDQAIASDKIYLMTTQVALPDNISKILEKLGVSMTTRPTQCTHLLAPQLVRTEKFLCALATAP
YILEASWATKSASAKQLLPEANFLLRDEKAEVKYGMKLEEALERARQLRGTLFIDKIFYVTPKTKVDFKLLKSVV
TTHGGQLMPQSPTVRSLKGHTDRYVISCPEDISIWRPLVAQNIPIFTQEFLLIGVLKQELDWDNRDLRVPGSVS*
Coding >AgabiH39|020330
ATGAGTCTCTTCCACAACACAAAATATTTTCTCGCAAATTCACTACCTCCGAATAGACAAGAACAACTTGAATAT
GCCTTGAGCAAGAACGGCGCAATTAAAGCCGATACTCTCACCAATGCTACACATATCATCACAAACTCGGCTCAC
TTCGAAGGCTCTGAATACATCGACCAAGGCGTCTTCGTCGTATCTGATCAATGGGTTGACCGCTCTCTTGTTCTT
GGCAAGCTCCAAGGACCGCAATATTATTCTGTGGACCCAGGAATGATCTTTTCAGGCATTGTAGCGTGCGCAACA
GAGCAACTTCCAACGCACGACCTTGAAGTCCTTTCTGCCGGAATCACTGCCCTCGGTGGTCAGTGGCGTGTTGCC
CTCACTAGCGACGTTACACATCTCTTCGCTACCTCCCCAAATTCTCCCAAGTACACGACCGCACTGGCTCATCGC
GACTCCGCTGGAATCAAGATTCTTTTGCCTCATTGGTTTGATGACTCAGTTCGACTCGGGATAAAGAACTTGTCC
GTCGAACCGTATCTCTGGCCCGACCCGCCACTCCTGACAGATATTGGAGCCACCGCAAATATCAAAACTCACAAC
AGGCAAAGTAGCGAAGACAAGGCCAAGAAAGCTCTGTTGAGCACGATGAATGACTTTACTCCATCCTTTGACTCA
AAGGTGCCCTTGCCCAAGGACGTTGACCTGATGTTGGTAAAGAAGAATGTATGGAATGGAAAGAGGATTTTATTG
AGTTGGACTTTGAGTCTATACGGATCGCGAAGAGAAGCAGTCGAAGCCGGAATCAGGAGAGCTGGAGGAATGGTT
TTGAGGTATCCGACCGATGACGATGAGGATCTTACCACTGAAGCGAGAGAGAAGAGGAGAGACAAGAAGGAAGCG
AGAGCAGTCGACGAATGTGATATTCTGATAACGAGGTGGCGGAGTGGAAGATCGTATGGCAGGGCTTTCCGACTA
CATAAAACGATTGGAACAATGGCTTGGTTATATCACGTCGAATCATCCGGACAGACACCTCGACCCGTTGACCAG
CTCCTCCATTACCCAGTTCCTCGAACGCCAATCAATAATTTTGGCATGCACGAAATTACGGTTACCAATTATACG
GGAGAAGCACGCGAGTACATCAAGAAATTAATTTCATCTATGGGCGCAAAGTTCACACCCAGTATGACGGGTAAA
AATACGGTCCTTATTGCCGCCTATATACAAGGTACCAAAGCAGACAAAGCTCGCGCTTGGTCAATTCCAATTGTC
AATCACACCTGGCTTGAGGATTGCTATATTCAATGGCGGCACCTTACGATGGCCACCGAGAAGTACATCGTCTTT
CCTCCTGGTGTCGATTTTAGTAAATTGCTGGGAGAACGTGGTGTCGGTATACGAGGAGTGGAACTATGTGATGAA
GAAGAGGGGAAAGAGGGGGACAGTGGGAGCGAAGATGAGAACGCCATGGACGTTGATCACGTCCAAGACGATGGT
GTATGGAAGGAGGACGAGCACGATGATCTTGATATACTCAGTATGCCTGACCCCGACGATTTACGCGAATTATCG
ATTCCGCCGCAACAAGCATTTAAAACGCCTTCTAAAAAGTCCCCGATGAAAAGCAAAGCGCATGGAAAGTCATCT
TCTGTGTCACCTTCGAAGAGAGTCATCTCGGCATCTGTCTCGCCTACGAAACGGGAAGTTGAGGTGGTTATAACT
CCGGCAAGAAAGGGTGCTTATTTGGATGCGATGAGGATTACACCTGGGAAATCAGCTTCAAAATCAAAATCGTCT
TCACCGGTCAAGCGGAGGACGATTGTTCCATCAAATGAGAGAGGTAGAGTAGGGAAGAAGGATGCTACAAGTGAT
GTGGATGGTGATGATGAGGGTACATCTCGATCTCGAGCTCAAACTCCCGAACTCGCTCCTATGGAAGTCGACGAA
GAAGGTATTGACAGAGACGTCGTTAACGTTTCCAACCCACCAAAGAAGAAACCCGTGATGAAGCCGAACTCCAAG
GCAAACGGGAGTGTAGGTTCGAAGAAGACAAAGAAAAGGATCGAGCTCATACCGGAACCAGAGGTATCTGGTGAA
TCAGACGCGACCCTGAATCGTACGCCGGCGACGTTGAGACGCTTAGCGAAGAAGACTCCGGACGCAGCTGAAGAT
GATATTCAAGATTCAAACAAAAAATCGTCGCCACGAAAGAGGCCAAACGAGGATGATGAAAGTTATCATCAGACA
ACTGAAGCAACGACTGCGACATCATCTGTGATTTCATCTAGACGGCTTATCCGAAGACTTACTAGCGAGGCAAGT
TCGGAACTTGAGAAGGAGAAGGAAAGGGAGAAGGAAAAGATGAAGAATCGATCTCTAACAAAGCTAACTCGTCGT
GCTACGAATGGCAGAATTCCCAGCGAGGAATCTGTTGATCATGAACTTGCCGGTAATGAAATTGAAACTGGTGAC
GAAGGGGAAGAGGAGAAGGAGAATGTTGTTGACGTTCATGTCAAGTCGCCTCGGAAATCCAAATCGGACGCTCCA
CCGTTGCCGAAGACTAGTCTATTGAAGATGACTCGTGGTGATGCAAGAACAAGAGTTAAAGTCAAAAGCGCTAAA
GCTAAAGCGCGAGAGCTTTATTCTAGCGAAGAAGAGGTGATGGATATTGTTAAAGACAAGCCTATGAAAGGCAAA
AAAGGAAAGGAGAAGGCGAAGGCGAAGGAGGAAATCAAACCGAAGAAGAAAGGGAGGCAATCGAAGGTTGTGTCG
GAGGACGAGGAAAGTACACATGTGGAGAGCGAGGAGGAGGAGGAGGTAGGGCAAGGAGGTGATCCTGCAACTAAG
AAAACAACTTTGAAGAGTTTAAAGACACGACCTTCGAGACAGAACCTCGTTGAGGTTGTCATTAATACACCAATG
AAGACGCCAGAAAAAACGCAAGCAAAGACCTATTCTTCTAAATCCAAAGGAAAGAAGAAGGCCGTCGCCGAAGAT
GAGGAGAACGCTGGTTCTTCTGAAGTTGAGAAAGATGCCGAAGAAACGGAAGAGGAGAAGCCGGTGTCGAGGCGG
GATTCATTGCGCAAACTCAAGAAGACAGAAAGTATCCGTGCTGAGGCAGAGGAAAAGGCCGTCAAGGCCTCAACC
TTGCGTCCCAAACCAATTTCCTTAGCCGGTTCTACACTTGGTTCCAAACCGAAATCCAAAAGGAGACAGTCGCAT
CACGTCTCGCCACCACCAGATTCATCCAGAACGCACACTCCTGTCACTGATACCAATGAACTCCTACCGGCGAAG
AGAGGCGCGGCAACGCGAGCTCAAGAAAAGTTGAAAGTCATGATGCCGGATGCAACGAAGTTCGAGGCAGAATTG
AGGAAGGCTAGGAAATCGGGTGGAGGGATGGCGGGCATCGGAATTGGAAGTTGGGAACAAGAAGAAGATAGTGGA
AGTGTGATTAAATCGAGGAATAAGAGGAAATCGAATGACATGGATGTTGATGAGGAGATGGAAGATGGTGGGAAA
AAGAGGAGAAGGTCGAGCGGAAAGGCACGGGCGGCGGAAGAGAACGAGGACGAGGTTGTCGAGGTTCCGCTGGGG
AAGAAGGCGAAGGCGAAAGCTAAACCATCAGACGGTCATGATCAAGCCATAGCATCTGACAAGATTTATCTTATG
ACGACTCAAGTTGCTTTACCCGATAACATCAGCAAGATTCTTGAGAAGCTTGGGGTTTCGATGACGACTAGGCCC
ACTCAGTGCACTCACCTTCTCGCCCCCCAGCTCGTAAGGACAGAGAAATTCTTATGTGCCTTGGCCACTGCTCCC
TATATACTTGAAGCTTCATGGGCGACGAAATCCGCCAGCGCGAAGCAGCTACTTCCCGAAGCTAACTTTTTACTA
CGTGATGAGAAAGCTGAGGTCAAGTATGGCATGAAGCTCGAGGAAGCACTTGAAAGAGCCAGACAACTTCGAGGG
ACACTTTTTATCGACAAGATATTCTATGTTACGCCCAAGACCAAAGTCGATTTCAAACTTCTCAAAAGTGTCGTC
ACTACGCATGGCGGTCAGCTGATGCCGCAGTCCCCGACCGTTCGCTCGCTAAAAGGGCACACAGATCGATATGTC
ATATCGTGCCCTGAAGATATATCTATATGGAGACCGCTAGTCGCGCAGAATATTCCTATTTTCACGCAAGAATTT
CTTTTGATTGGCGTGTTGAAACAAGAGCTCGATTGGGATAATAGGGATCTAAGAGTACCAGGGTCAGTTTCGTGA
Transcript >AgabiH39|020330
ATGAGTCTCTTCCACAACACAAAATATTTTCTCGCAAATTCACTACCTCCGAATAGACAAGAACAACTTGAATAT
GCCTTGAGCAAGAACGGCGCAATTAAAGCCGATACTCTCACCAATGCTACACATATCATCACAAACTCGGCTCAC
TTCGAAGGCTCTGAATACATCGACCAAGGCGTCTTCGTCGTATCTGATCAATGGGTTGACCGCTCTCTTGTTCTT
GGCAAGCTCCAAGGACCGCAATATTATTCTGTGGACCCAGGAATGATCTTTTCAGGCATTGTAGCGTGCGCAACA
GAGCAACTTCCAACGCACGACCTTGAAGTCCTTTCTGCCGGAATCACTGCCCTCGGTGGTCAGTGGCGTGTTGCC
CTCACTAGCGACGTTACACATCTCTTCGCTACCTCCCCAAATTCTCCCAAGTACACGACCGCACTGGCTCATCGC
GACTCCGCTGGAATCAAGATTCTTTTGCCTCATTGGTTTGATGACTCAGTTCGACTCGGGATAAAGAACTTGTCC
GTCGAACCGTATCTCTGGCCCGACCCGCCACTCCTGACAGATATTGGAGCCACCGCAAATATCAAAACTCACAAC
AGGCAAAGTAGCGAAGACAAGGCCAAGAAAGCTCTGTTGAGCACGATGAATGACTTTACTCCATCCTTTGACTCA
AAGGTGCCCTTGCCCAAGGACGTTGACCTGATGTTGGTAAAGAAGAATGTATGGAATGGAAAGAGGATTTTATTG
AGTTGGACTTTGAGTCTATACGGATCGCGAAGAGAAGCAGTCGAAGCCGGAATCAGGAGAGCTGGAGGAATGGTT
TTGAGGTATCCGACCGATGACGATGAGGATCTTACCACTGAAGCGAGAGAGAAGAGGAGAGACAAGAAGGAAGCG
AGAGCAGTCGACGAATGTGATATTCTGATAACGAGGTGGCGGAGTGGAAGATCGTATGGCAGGGCTTTCCGACTA
CATAAAACGATTGGAACAATGGCTTGGTTATATCACGTCGAATCATCCGGACAGACACCTCGACCCGTTGACCAG
CTCCTCCATTACCCAGTTCCTCGAACGCCAATCAATAATTTTGGCATGCACGAAATTACGGTTACCAATTATACG
GGAGAAGCACGCGAGTACATCAAGAAATTAATTTCATCTATGGGCGCAAAGTTCACACCCAGTATGACGGGTAAA
AATACGGTCCTTATTGCCGCCTATATACAAGGTACCAAAGCAGACAAAGCTCGCGCTTGGTCAATTCCAATTGTC
AATCACACCTGGCTTGAGGATTGCTATATTCAATGGCGGCACCTTACGATGGCCACCGAGAAGTACATCGTCTTT
CCTCCTGGTGTCGATTTTAGTAAATTGCTGGGAGAACGTGGTGTCGGTATACGAGGAGTGGAACTATGTGATGAA
GAAGAGGGGAAAGAGGGGGACAGTGGGAGCGAAGATGAGAACGCCATGGACGTTGATCACGTCCAAGACGATGGT
GTATGGAAGGAGGACGAGCACGATGATCTTGATATACTCAGTATGCCTGACCCCGACGATTTACGCGAATTATCG
ATTCCGCCGCAACAAGCATTTAAAACGCCTTCTAAAAAGTCCCCGATGAAAAGCAAAGCGCATGGAAAGTCATCT
TCTGTGTCACCTTCGAAGAGAGTCATCTCGGCATCTGTCTCGCCTACGAAACGGGAAGTTGAGGTGGTTATAACT
CCGGCAAGAAAGGGTGCTTATTTGGATGCGATGAGGATTACACCTGGGAAATCAGCTTCAAAATCAAAATCGTCT
TCACCGGTCAAGCGGAGGACGATTGTTCCATCAAATGAGAGAGGTAGAGTAGGGAAGAAGGATGCTACAAGTGAT
GTGGATGGTGATGATGAGGGTACATCTCGATCTCGAGCTCAAACTCCCGAACTCGCTCCTATGGAAGTCGACGAA
GAAGGTATTGACAGAGACGTCGTTAACGTTTCCAACCCACCAAAGAAGAAACCCGTGATGAAGCCGAACTCCAAG
GCAAACGGGAGTGTAGGTTCGAAGAAGACAAAGAAAAGGATCGAGCTCATACCGGAACCAGAGGTATCTGGTGAA
TCAGACGCGACCCTGAATCGTACGCCGGCGACGTTGAGACGCTTAGCGAAGAAGACTCCGGACGCAGCTGAAGAT
GATATTCAAGATTCAAACAAAAAATCGTCGCCACGAAAGAGGCCAAACGAGGATGATGAAAGTTATCATCAGACA
ACTGAAGCAACGACTGCGACATCATCTGTGATTTCATCTAGACGGCTTATCCGAAGACTTACTAGCGAGGCAAGT
TCGGAACTTGAGAAGGAGAAGGAAAGGGAGAAGGAAAAGATGAAGAATCGATCTCTAACAAAGCTAACTCGTCGT
GCTACGAATGGCAGAATTCCCAGCGAGGAATCTGTTGATCATGAACTTGCCGGTAATGAAATTGAAACTGGTGAC
GAAGGGGAAGAGGAGAAGGAGAATGTTGTTGACGTTCATGTCAAGTCGCCTCGGAAATCCAAATCGGACGCTCCA
CCGTTGCCGAAGACTAGTCTATTGAAGATGACTCGTGGTGATGCAAGAACAAGAGTTAAAGTCAAAAGCGCTAAA
GCTAAAGCGCGAGAGCTTTATTCTAGCGAAGAAGAGGTGATGGATATTGTTAAAGACAAGCCTATGAAAGGCAAA
AAAGGAAAGGAGAAGGCGAAGGCGAAGGAGGAAATCAAACCGAAGAAGAAAGGGAGGCAATCGAAGGTTGTGTCG
GAGGACGAGGAAAGTACACATGTGGAGAGCGAGGAGGAGGAGGAGGTAGGGCAAGGAGGTGATCCTGCAACTAAG
AAAACAACTTTGAAGAGTTTAAAGACACGACCTTCGAGACAGAACCTCGTTGAGGTTGTCATTAATACACCAATG
AAGACGCCAGAAAAAACGCAAGCAAAGACCTATTCTTCTAAATCCAAAGGAAAGAAGAAGGCCGTCGCCGAAGAT
GAGGAGAACGCTGGTTCTTCTGAAGTTGAGAAAGATGCCGAAGAAACGGAAGAGGAGAAGCCGGTGTCGAGGCGG
GATTCATTGCGCAAACTCAAGAAGACAGAAAGTATCCGTGCTGAGGCAGAGGAAAAGGCCGTCAAGGCCTCAACC
TTGCGTCCCAAACCAATTTCCTTAGCCGGTTCTACACTTGGTTCCAAACCGAAATCCAAAAGGAGACAGTCGCAT
CACGTCTCGCCACCACCAGATTCATCCAGAACGCACACTCCTGTCACTGATACCAATGAACTCCTACCGGCGAAG
AGAGGCGCGGCAACGCGAGCTCAAGAAAAGTTGAAAGTCATGATGCCGGATGCAACGAAGTTCGAGGCAGAATTG
AGGAAGGCTAGGAAATCGGGTGGAGGGATGGCGGGCATCGGAATTGGAAGTTGGGAACAAGAAGAAGATAGTGGA
AGTGTGATTAAATCGAGGAATAAGAGGAAATCGAATGACATGGATGTTGATGAGGAGATGGAAGATGGTGGGAAA
AAGAGGAGAAGGTCGAGCGGAAAGGCACGGGCGGCGGAAGAGAACGAGGACGAGGTTGTCGAGGTTCCGCTGGGG
AAGAAGGCGAAGGCGAAAGCTAAACCATCAGACGGTCATGATCAAGCCATAGCATCTGACAAGATTTATCTTATG
ACGACTCAAGTTGCTTTACCCGATAACATCAGCAAGATTCTTGAGAAGCTTGGGGTTTCGATGACGACTAGGCCC
ACTCAGTGCACTCACCTTCTCGCCCCCCAGCTCGTAAGGACAGAGAAATTCTTATGTGCCTTGGCCACTGCTCCC
TATATACTTGAAGCTTCATGGGCGACGAAATCCGCCAGCGCGAAGCAGCTACTTCCCGAAGCTAACTTTTTACTA
CGTGATGAGAAAGCTGAGGTCAAGTATGGCATGAAGCTCGAGGAAGCACTTGAAAGAGCCAGACAACTTCGAGGG
ACACTTTTTATCGACAAGATATTCTATGTTACGCCCAAGACCAAAGTCGATTTCAAACTTCTCAAAAGTGTCGTC
ACTACGCATGGCGGTCAGCTGATGCCGCAGTCCCCGACCGTTCGCTCGCTAAAAGGGCACACAGATCGATATGTC
ATATCGTGCCCTGAAGATATATCTATATGGAGACCGCTAGTCGCGCAGAATATTCCTATTTTCACGCAAGAATTT
CTTTTGATTGGCGTGTTGAAACAAGAGCTCGATTGGGATAATAGGGATCTAAGAGTACCAGGGTCAGTTTCGTGA
Gene >AgabiH39|020330
ATGAGTCTCTTCCACAACACAAAATATTTTCTCGCAAATTCACTACCTCCGAATAGACAAGAACAACTTGAATAT
GCCTTGAGCAAGAACGGCGCAATTAAAGCCGATACTCTCACCAATGCTACACATATCATCACAAACTCGGCTCAC
TTCGAAGGCTCTGAATACATCGACCAAGGCGTCTTCGTCGTATCTGTACGTCTATCTGTTGCATCGCATAGTATG
GAGACTGTAATGATTATCTAGGATCAATGGGTTGACCGCTCTCTTGTTCTTGGCAAGCTCCAAGGGTATGTTTTA
TCATCGTCAAAGAGCCACCGCTGAAGTCAGACTAAGACCGCAATATTATTCTGTGGACCCAGGAATGATCTTTTC
AGGCATTGTAGCGTGCGCAACAGAGGTGAGCACCAAATGCACATGTTAACTTAGATTCTTTACCATGCATGTCTT
AGCAACTTCCAACGCACGACCTTGAAGTCCTTTCTGCCGGAATCACTGCCCTCGGTGGTCAGTGGCGTGTTGCCC
TCACTAGCGACGTTACACATCTCTTCGCTACCTCCCCAAATTCTCCCAAGTACACGACCGCACTGGCTCATCGCG
ACTCCGCTGGAATCAAGATTCTTTTGCCTCATTGGTTTGATGACTCAGTTCGACTCGGGATAAAGAACTTGTCCG
TCGAACCGTATCTCTGGCCCGACCCGCCACTCCTGACAGATATTGGAGCCACCGCAAATATCAAAACTCACAACA
GGCAAAGTAGCGAAGACAAGGCCAAGAAAGCTCTGTTGAGCACGATGAATGACTTTACTCCATCCTTTGACTCAA
AGGTGCCCTTGCCCAAGGACGTTGACCTGATGTTGGTAAAGAAGAATGTATGGAATGGAAAGAGGATTTTATTGA
GTTGGACTTTGAGTCTATACGGATCGCGAAGAGAAGCAGTCGAAGCCGGAATCAGGAGAGCTGGAGGAATGGTTT
TGAGGTATCCGACCGATGACGATGAGGATCTTACCACTGAAGCGAGAGAGAAGAGGAGAGACAAGAAGGAAGCGA
GAGCAGTCGACGAATGTGATATTCTGATAACGAGGTGGCGGAGTGGAAGATCGTATGGCAGGGTATGCAGTAAAT
CATTCGTTTTGTTCAACATGACTCACGTCCATCATCAGGCTTTCCGACTACATAAAACGATTGGAACAATGGCTT
GGTTATATCACGTCGAATCATCCGGACAGACACCTCGACCCGTTGACCAGCTCCTCCATTACCCAGTTCCTCGAA
CGCCAATCAATAATTTTGGCATGCACGTATGTGTGCTCCCTCTTCTCTTCTGCAAAAGGACCTTGTGACGATCCA
CTACTCAGGAAATTACGGTTACCAATTATACGGGAGAAGCACGCGAGTACATCAAGAAATTAATTTCATCTATGG
GCGCAAAGTTCACACCCAGTATGACGGGTAAAAATACGGTCCTTATTGCCGCCTAGTAAACCCTCTTTGTCTTTC
TTTTGAATTACTCGCTTACATATATCTTTCTTAGTATACAAGGTACCAAAGCAGACAAAGCTCGCGCTTGGTCAA
TTCCAATTGTCAATCACACCTGGCTTGAGGATTGCTATATTCAATGGCGGCACCTTACGATGGCCACCGAGAAGT
ACATCGTCTTTCCTCCTGGTGTCGATTTTAGTAAATTGCTGGGAGAACGTGGTGTCGGTATACGAGGAGTGGAAC
TATGTGATGAAGAAGAGGGGAAAGAGGGGGACAGTGGGAGCGAAGATGAGAACGCCATGGACGTTGATCACGTCC
AAGACGATGGTGTATGGAAGGAGGACGAGCACGATGATCTTGATATACTCAGTATGCCTGACCCCGACGATTTAC
GCGAATTATCGATTCCGCCGCAACAAGCATTTAAAACGCCTTCTAAAAAGTCCCCGATGAAAAGCAAAGCGCATG
GAAAGTCATCTTCTGTGTCACCTTCGAAGAGAGTCATCTCGGCATCTGTCTCGCCTACGAAACGGGAAGTTGAGG
TGGTTATAACTCCGGCAAGAAAGGGTGCTTATTTGGATGCGATGAGGATTACACCTGGGAAATCAGCTTCAAAAT
CAAAATCGTCTTCACCGGTCAAGCGGAGGACGATTGTTCCATCAAATGAGAGAGGTAGAGTAGGGAAGAAGGATG
CTACAAGTGATGTGGATGGTGATGATGAGGGTACATCTCGATCTCGAGCTCAAACTCCCGAACTCGCTCCTATGG
AAGTCGACGAAGAAGGTATTGACAGAGACGTCGTTAACGTTTCCAACCCACCAAAGAAGAAACCCGTGATGAAGC
CGAACTCCAAGGCAAACGGGAGTGTAGGTTCGAAGAAGACAAAGAAAAGGATCGAGCTCATACCGGAACCAGAGG
TATCTGGTGAATCAGACGCGACCCTGAATCGTACGCCGGCGACGTTGAGACGCTTAGCGAAGAAGACTCCGGACG
CAGCTGAAGATGATATTCAAGATTCAAACAAAAAATCGTCGCCACGAAAGAGGCCAAACGAGGATGATGAAAGTT
ATCATCAGACAACTGAAGCAACGACTGCGACATCATCTGTGATTTCATCTGCAAGTTCACCCGCTGCTACATCTG
ACGTTTCATCTGCCGTTTCTCAACCTCCTCCGAAGAGACGGCTTATCCGAAGACTTACTAGCGAGGCAAGTTCGG
AACTTGAGAAGGAGAAGGAAAGGGAGAAGGAAAAGATGAAGAATCGATCTCTAACAAAGCTAACTCGTCGTGCTA
CGAATGGCAGAATTCCCAGCGAGGAATCTGTTGATCATGAACTTGCCGGTAATGAAATTGAAACTGGTGACGAAG
GGGAAGAGGAGAAGGAGAATGTTGTTGACGTTCATGTCAAGTCGCCTCGGAAATCCAAATCGGACGCTCCACCGT
TGCCGAAGACTAGTCTATTGAAGATGACTCGTGGTGATGCAAGAACAAGAGTTAAAGTCAAAAGCGCTAAAGCTA
AAGCGCGAGAGCTTTATTCTAGCGAAGAAGAGGTGATGGATATTGTTAAAGACAAGCCTATGAAAGGCAAAAAAG
GAAAGGAGAAGGCGAAGGCGAAGGAGGAAATCAAACCGAAGAAGAAAGGGAGGCAATCGAAGGTTGTGTCGGAGG
ACGAGGAAAGTACACATGTGGAGAGCGAGGAGGAGGAGGAGGTAGGGCAAGGAGGTGATCCTGCAACTAAGAAAA
CAACTTTGAAGAGTTTAAAGACACGACCTTCGAGACAGAACCTCGTTGAGGTTGTCATTAATACACCAATGAAGA
CGCCAGAAAAAACGCAAGCAAAGACCTATTCTTCTAAATCCAAAGGAAAGAAGAAGGCCGTCGCCGAAGATGAGG
AGAACGCTGGTTCTTCTGAAGTTGAGAAAGATGCCGAAGAAACGGAAGAGGAGAAGCCGGTGTCGAGGCGGGATT
CATTGCGCAAACTCAAGAAGACAGAAAGTATCCGTGCTGAGGCAGAGGAAAAGGCCGTCAAGGCCTCAACCTTGC
GTCCCAAACCAATTTCCTTAGCCGGTTCTACACTTGGTTCCAAACCGAAATCCAAAAGGAGACAGTCGCATCACG
TCTCGCCACCACCAGATTCATCCAGAACGCACACTCCTGTCACTGATACCAATGAACTCCTACCGGCGAAGAGAG
GCGCGGCAACGCGAGCTCAAGAAAAGTTGAAAGTCATGATGCCGGATGCAACGAAGTTCGAGGCAGAATTGAGGA
AGGCTAGGAAATCGGGTGGAGGGATGGCGGGCATCGGAATTGGAAGTTGGGAACAAGAAGAAGATAGTGGAAGTG
TGATTAAATCGAGGAATAAGAGGAAATCGAATGACATGGATGTTGATGAGGAGATGGAAGATGGTGGGAAAAAGA
GGAGAAGGTCGAGCGGAAAGGCACGGGCGGCGGAAGAGAACGAGGACGAGGTTGTCGAGGTTCCGCTGGGGAAGA
AGGCGAAGGCGAAAGCTAAACCATCAGACGGTCATGATCAAGCCATAGCGTGAGTGTTTTTTAAACAATCATGTT
CAAGATCTCCAGTTTACGCTCTTTTGAAGATCTGACAAGATTTATCTTATGACGACTCAAGTTGCTTTACCCGAT
AACATCAGCAAGGCACGTTCTTCTCTGTCTTAGTCTCCATTGTGCATTGATTGTTCAATTATTCAGATTCTTGAG
AAGCTTGGGGTTTCGATGACGACTAGGCCCACTCAGTGCACTCACCTTCTCGCCCCCCAGCTCGTAAGGACAGAG
AAATTCTTATGTGCCTTGGCCACTGCTCCCTATATACTTGAAGCTTCATGGGCGACGAAATCCGCCAGCGCGAAG
CAGCTACTTCGTGAGCCTACTTCTGATCTCGAGTTCTACAATCGTTGCTGATGTTTCCACTAAAGCCGAAGCTAA
CTTTTTACTACGTGATGAGAAAGCTGAGGTCAAGTATGGCATGAAGCTCGAGGAAGCACTTGAAAGAGCCAGACA
ACTTCGAGGGACACTTTTTATCGACAAGATATTCTATGTTACGCCCAAGACCAAAGTCGATTTCAAACTTCTCAA
AAGTGTCGTCACTACGCATGGCGGTCAGGTAAGTAGCTAACTTGCAACTATCGATTCGATCTTCATCATCTATAT
CTCGCCTTTTTTTAGCTGATGCCGCAGTCCCCGACCGTTCGCTCGCTAAAAGGGCACACAGATCGATATGTCATA
TCGTGCCCTGAAGATATATCTATATGGAGACCGCTAGTCGCGCAGAATATTCCTATTTTCACGCAAGAATTTCTT
TTGATTGGCGTGTTGAAACAAGAGCTCGATTGGGATAATAGGGATCTAAGAGTACCAGGGTCAGTTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail