Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|020250
Gene name
Locationscaffold_10:1376332..1378422
Strand+
Gene length (bp)2090
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20152 DUF6534 Family of unknown function (DUF6534) 2.2E-14 177 263

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 62 84 22
3 99 121 22
4 134 156 22
5 171 193 22
6 213 235 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup19
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|004100
Agaricus bisporus var bisporus H39 AgabiH39|406100
Agaricus bisporus var bisporus H39 AgabiH39|386300
Agaricus bisporus var bisporus H39 AgabiH39|386200
Agaricus bisporus var bisporus H39 AgabiH39|102060
Agaricus bisporus var bisporus H39 AgabiH39|095970
Agaricus bisporus var bisporus H39 AgabiH39|103490
Agaricus bisporus var bisporus H39 AgabiH39|095720
Agaricus bisporus var bisporus H39 AgabiH39|022930
Agaricus bisporus var bisporus H39 AgabiH39|020260
Agaricus bisporus var bisporus H39 AgabiH39|020250 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|095960
Agaricus bisporus var bisporus H97 AgabiH97|096260
Agaricus bisporus var bisporus H97 AgabiH97|103490
Agaricus bisporus var bisporus H97 AgabiH97|103480
Agaricus bisporus var bisporus H97 AgabiH97|103470
Agaricus bisporus var bisporus H97 AgabiH97|102060
Agaricus bisporus var bisporus H97 AgabiH97|096250
Agaricus bisporus var bisporus H97 AgabiH97|020260
Agaricus bisporus var bisporus H97 AgabiH97|095960
Agaricus bisporus var bisporus H97 AgabiH97|095720
Agaricus bisporus var bisporus H97 AgabiH97|022930
Agaricus bisporus var bisporus H97 AgabiH97|020250
Agaricus bisporus var bisporus H97 AgabiH97|004100
Agaricus bisporus var bisporus H97 AgabiH97|095970
Rhodonia placenta FPRL280 RhoplFPRL280|25_45
Rhodonia placenta FPRL280 RhoplFPRL280|168_9
Rhodonia placenta FPRL280 RhoplFPRL280|227_13
Rhodonia placenta FPRL280 RhoplFPRL280|435_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|020250
MSTSVTSAPSPSATFLPPPDVQLSYGPMLLGVFANMILYGILVAQTFSYYQLYKNDARWIKALVVYLFIIETANT
GIDMAMMYQPLILEYGQQLLSFPVMFAAEPVTIVAISMPIQLFFAWRIFRLTKMTVIPVIVSLLSFVSFAGGIWT
TVKIIMIKSFSRKPELHWSALVWFLSACVADVLITLTLVLNLSRRKTGFSATDDVISKIIRMTVQTGFLTALFAI
GDVVFFMTLGKTALNFLWDLALTKIYANCLMSTLNARAALKEMSSSNHSNTRPFSTMVGASRRPNTGTDHIPPSH
MLELARMSYERSRSQIDDPEYGITVTKVVETMQDEESFHPKGAAL*
Coding >AgabiH39|020250
ATGTCTACTTCAGTGACGTCGGCTCCTTCGCCATCTGCAACGTTCCTTCCTCCACCTGATGTGCAACTATCGTAT
GGGCCGATGCTGCTTGGAGTCTTCGCGAATATGATACTATATGGGATTCTAGTAGCTCAGACTTTTTCGTACTAC
CAGCTTTACAAGAATGATGCACGTTGGATCAAGGCTTTGGTCGTCTATCTCTTTATCATCGAGACCGCAAACACG
GGAATAGATATGGCGATGATGTATCAGCCTCTCATATTGGAATATGGGCAACAGCTGCTTTCATTCCCAGTCATG
TTCGCTGCCGAACCGGTTACAATTGTTGCTATCTCTATGCCTATCCAGCTATTTTTCGCCTGGAGAATCTTTCGT
CTCACGAAAATGACAGTCATTCCTGTTATCGTTTCGCTACTATCATTCGTTTCTTTTGCTGGCGGTATATGGACA
ACTGTTAAGATCATAATGATCAAATCTTTCAGCCGCAAACCCGAACTTCACTGGTCGGCTCTTGTATGGTTTCTC
TCAGCATGCGTTGCCGACGTCCTTATCACTTTAACGCTCGTATTAAACTTGTCGAGGCGTAAGACAGGATTTTCC
GCGACAGACGACGTTATTTCGAAAATAATCCGAATGACGGTCCAGACTGGATTCTTAACTGCTCTTTTCGCAATC
GGGGATGTTGTATTTTTCATGACTCTCGGAAAAACGGCTTTGAACTTCCTCTGGGATTTAGCTCTCACTAAAATT
TACGCGAATTGCCTAATGTCCACTTTGAATGCCCGGGCTGCTTTGAAAGAAATGTCAAGCAGTAATCATTCAAAC
ACGCGCCCTTTCTCAACTATGGTTGGGGCCAGTAGACGACCCAACACCGGTACAGACCACATTCCACCATCGCAT
ATGTTAGAACTAGCGCGAATGTCATACGAGAGGTCACGATCACAGATAGATGACCCTGAGTACGGCATCACAGTA
ACAAAGGTCGTGGAAACCATGCAGGATGAGGAGTCATTTCACCCAAAAGGTGCCGCTCTTTAA
Transcript >AgabiH39|020250
ATGTCTACTTCAGTGACGTCGGCTCCTTCGCCATCTGCAACGTTCCTTCCTCCACCTGATGTGCAACTATCGTAT
GGGCCGATGCTGCTTGGAGTCTTCGCGAATATGATACTATATGGGATTCTAGTAGCTCAGACTTTTTCGTACTAC
CAGCTTTACAAGAATGATGCACGTTGGATCAAGGCTTTGGTCGTCTATCTCTTTATCATCGAGACCGCAAACACG
GGAATAGATATGGCGATGATGTATCAGCCTCTCATATTGGAATATGGGCAACAGCTGCTTTCATTCCCAGTCATG
TTCGCTGCCGAACCGGTTACAATTGTTGCTATCTCTATGCCTATCCAGCTATTTTTCGCCTGGAGAATCTTTCGT
CTCACGAAAATGACAGTCATTCCTGTTATCGTTTCGCTACTATCATTCGTTTCTTTTGCTGGCGGTATATGGACA
ACTGTTAAGATCATAATGATCAAATCTTTCAGCCGCAAACCCGAACTTCACTGGTCGGCTCTTGTATGGTTTCTC
TCAGCATGCGTTGCCGACGTCCTTATCACTTTAACGCTCGTATTAAACTTGTCGAGGCGTAAGACAGGATTTTCC
GCGACAGACGACGTTATTTCGAAAATAATCCGAATGACGGTCCAGACTGGATTCTTAACTGCTCTTTTCGCAATC
GGGGATGTTGTATTTTTCATGACTCTCGGAAAAACGGCTTTGAACTTCCTCTGGGATTTAGCTCTCACTAAAATT
TACGCGAATTGCCTAATGTCCACTTTGAATGCCCGGGCTGCTTTGAAAGAAATGTCAAGCAGTAATCATTCAAAC
ACGCGCCCTTTCTCAACTATGGTTGGGGCCAGTAGACGACCCAACACCGGTACAGACCACATTCCACCATCGCAT
ATGTTAGAACTAGCGCGAATGTCATACGAGAGGTCACGATCACAGATAGATGACCCTGAGTACGGCATCACAGTA
ACAAAGGTCGTGGAAACCATGCAGGATGAGGAGTCATTTCACCCAAAAGGTGCCGCTCTTTAA
Gene >AgabiH39|020250
ATGTCTACTTCAGTGACGTCGGCTCCTTCGCCATCTGCAACGTTCCTTCCTCCACCTGATGTGCAACTATCGTAA
GTCTTCTATCCTATGGCTGGGCTATGTCAAACATAGGATTAGGTATGGGCCGATGCTGCTTGGAGTCTTCGCGAA
TATGATACTATATGGGGTGCGTATGATGACTTCCTGGGACAATGGCAGAGATTGACGCTCATTCCTAGATTCTAG
TAGCTCAGGTACTTCGGCAATGTGTTTATGAAATCCAACGCTTATCTAAATCCGCGTTTCAACAGACTTTTTCGT
ACTACCAGCTTTACAAGAAGTATGATGTCTCTGCAAGAATGTTCGAACAACGACTTAATCATTAAACAGTGATGC
ACGTTGGATCAAGGCTTTGGTGAGCTTCAAGCAAACCCCAAGGGTTACCATGGCTTAATATACCTAGGTCGTCTA
TCTCTTTATCATCGAGACCGCAAACACGGGAATAGATATGGCGATGATGTATCAGCCTCTCATATTGGAATATGG
TCCGTCGTTTCATACTTTCTCTGGTGAATGGGTATTTAGGCTCCCCACAGGGCAACAGCTGCTTTCATTCCCAGT
CAGTGAGTAAAGCCTCTTAATCTAATCATATGCCTATTTAATAACCTTTGTTGGATTCAGTGTTCGCTGCCGGTC
TGTACAGCTTCATCCTCGTTTGTTAGCGATGAAATGCTTATATCTATTCCATTTGCCTGCAGAACCGGTTACAAT
TGTAAGCCTGGTCTCTCATGGCTGGTGTACTGAGGTCCTGACTGGTGTTAGGTTGCTATCTCTATGCCTATCCAG
CTATTTTTCGCCTGGAGAATCTTTCGTCTCACGAAAATGACAGTCATTCCTGTTATCGTTTCGCTACTATCATTC
GTTTCTTTTGGTACGTCCGCTAGTCTCTTTTCATCTGCAATCGCTAACTTTCCCCCTCCTTAAAGCTGGCGGTAT
ATGGACAACTGTTAAGATCATAATGATCAAATCTTTCAGCCGCAAACCCGAACTTCACTGGTCGGCTCTTGTATG
GTTTCTCTCAGCATGCGTTGCCGACGTCCTTATCACTTTAACGCTCGTATTAAACTTGGTGAGTTATCCCAATGC
TATGAACCCTATTATCCCCCTCCTCGCGGCACTGTATTGATCAAGGTTTGCACATGATCGTAGTCGAGGCGTAAG
ACAGGATTTTCCGCGACAGACGACGTTATTTCGAAAATAATCCGAAGTAGGTTCTTGGTTACATCGCTTCGCAAC
TGTCACTCATCATTTATCTAAGTGACGGTCCAGACTGGATTCTTAACGTAGGTCTTTTGACACGCCCATTATTTT
TAGACCTTCAATTGAGTCTTTCTAACAGTGCTCTTTTCGCAATCGGGGATGTTGTATTTTTCATGAGTGAGCTCT
ATCCTTTTTTGTAGAAGTACCCGACGTTAATCTGTTTCATCCAGCTCTCGGAGTACGTCAATTCATGGCGTTGTA
GCACATGTGTGTTCTGAATTTGTTCTTGATGGACATAGAAAACGGCTTTGTACGTCAAAACACTCGTTTGACGTC
TCTTCGCACAGGCTGATTTACGAGACAGGAACTTCCTCTGGGATTTAGCTCTCACTAAAATTTACGCGAATTGCC
TAATGTCCACTTTGAATGCCCGGGCTGCTTTGAAAGAAATGTCAAGCAGTAATCATTCAAACACGCGCCCTTTCT
CAACTATGGTTGGGGCCAGTAGACGACCCGTGCGCTCTCACCATATTTTCTGTGCTGTTGTCCGCATCTAACTAT
TTTCTAGAACACCGGTACAGACCACATTCCACCAGTGAGTTCAATAGTGATAAAGTCTCACCGGCACTGATGCAA
CCTCTTGTACCCACGTTCAGTCGCATATGTTAGAACTAGCGCGAATGTCATACGAGAGGTCACGATCACAGATAG
ATGACCCTGAGTACGGCATCACAGTAACAAAGGCACGTCTTTGATTTGTCCCGTCACTCAGTGAGAATCAACGTA
TTATATAGGTCGTGGAAACCATGCAGGATGAGGAGTCATTTCACCCAAAAGGTGCCGCTCTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail