Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|020020
Gene name
Locationscaffold_10:1319712..1321125
Strand+
Gene length (bp)1413
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 72 19
3 92 113 21
4 115 137 22
5 147 169 22
6 201 221 20
7 226 248 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1245
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|019720
Agaricus bisporus var bisporus H39 AgabiH39|019730
Agaricus bisporus var bisporus H39 AgabiH39|019740
Agaricus bisporus var bisporus H39 AgabiH39|019750
Agaricus bisporus var bisporus H39 AgabiH39|019950
Agaricus bisporus var bisporus H39 AgabiH39|020020 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|479900
Agaricus bisporus var bisporus H39 AgabiH39|539400
Agaricus bisporus var bisporus H97 AgabiH97|019720
Agaricus bisporus var bisporus H97 AgabiH97|019730
Agaricus bisporus var bisporus H97 AgabiH97|019740
Agaricus bisporus var bisporus H97 AgabiH97|019750
Agaricus bisporus var bisporus H97 AgabiH97|019950
Agaricus bisporus var bisporus H97 AgabiH97|020020
Agaricus bisporus var bisporus H97 AgabiH97|020210
Agaricus bisporus var bisporus H97 AgabiH97|034710

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|020020
MGHSFPEGQVLALMIGSILYGLNLVTVWLTLQRLFRERGNWKRGWDINFPMTAVVIVLFMASTTNLALQVALVMR
MLSQSRPEDFRVERSKIIVAQAILLILETIIADGVLLFRCWIVWNKMILIIVLPLVLWVGLAALDLGAKTYAASV
AFWTATITVNIYCTGLIVGRICAVQQGWRPPSICSLQNLPQRGRLQLAKRIVIESAMMYTVSSLSAFISHICPVS
AAINITCIAEAQIIGIAFNLILIRPWSQKQDHESELCKPRTRWLICHNMPSNNIALGDGNLRLRLCHDL*
Coding >AgabiH39|020020
ATGGGTCATTCTTTTCCTGAAGGCCAAGTGCTGGCGCTCATGATTGGATCCATATTATATGGCCTGAACTTAGTT
ACGGTTTGGTTAACTCTTCAGCGTCTTTTCAGAGAGAGAGGAAACTGGAAACGCGGTTGGGACATCAATTTCCCT
ATGACGGCGGTCGTTATCGTACTCTTTATGGCGTCGACGACAAACTTGGCACTCCAAGTTGCTCTTGTAATGCGG
ATGTTGTCGCAGTCTCGTCCAGAGGACTTTCGGGTGGAGCGAAGTAAAATCATCGTTGCACAAGCTATCCTGTTG
ATTCTTGAGACGATTATTGCTGATGGTGTACTGCTCTTCAGATGCTGGATCGTCTGGAATAAGATGATCCTTATT
ATCGTCCTACCCCTGGTTCTTTGGGTGGGATTGGCAGCTCTTGATCTTGGGGCAAAGACATATGCAGCCTCCGTG
GCATTCTGGACTGCCACAATCACAGTGAATATCTACTGTACGGGATTGATTGTAGGGAGAATTTGTGCCGTACAA
CAGGGTTGGAGACCGCCCTCCATATGTTCTTTACAGAATTTACCGCAACGAGGTCGATTGCAACTGGCCAAACGC
ATAGTCATTGAGTCGGCTATGATGTACACCGTGTCATCTTTGAGTGCCTTTATCAGTCATATTTGTCCAGTGAGC
GCCGCAATTAACATTACATGTATAGCAGAAGCTCAAATCATCGGAATTGCCTTTAATCTGATACTTATCAGACCA
TGGTCTCAGAAGCAGGACCATGAAAGCGAGTTATGCAAACCACGGACTCGCTGGTTGATATGCCATAATATGCCT
TCGAATAATATAGCGCTCGGCGATGGCAACCTCCGGCTCAGACTATGCCATGATTTATAG
Transcript >AgabiH39|020020
ATGGGTCATTCTTTTCCTGAAGGCCAAGTGCTGGCGCTCATGATTGGATCCATATTATATGGCCTGAACTTAGTT
ACGGTTTGGTTAACTCTTCAGCGTCTTTTCAGAGAGAGAGGAAACTGGAAACGCGGTTGGGACATCAATTTCCCT
ATGACGGCGGTCGTTATCGTACTCTTTATGGCGTCGACGACAAACTTGGCACTCCAAGTTGCTCTTGTAATGCGG
ATGTTGTCGCAGTCTCGTCCAGAGGACTTTCGGGTGGAGCGAAGTAAAATCATCGTTGCACAAGCTATCCTGTTG
ATTCTTGAGACGATTATTGCTGATGGTGTACTGCTCTTCAGATGCTGGATCGTCTGGAATAAGATGATCCTTATT
ATCGTCCTACCCCTGGTTCTTTGGGTGGGATTGGCAGCTCTTGATCTTGGGGCAAAGACATATGCAGCCTCCGTG
GCATTCTGGACTGCCACAATCACAGTGAATATCTACTGTACGGGATTGATTGTAGGGAGAATTTGTGCCGTACAA
CAGGGTTGGAGACCGCCCTCCATATGTTCTTTACAGAATTTACCGCAACGAGGTCGATTGCAACTGGCCAAACGC
ATAGTCATTGAGTCGGCTATGATGTACACCGTGTCATCTTTGAGTGCCTTTATCAGTCATATTTGTCCAGTGAGC
GCCGCAATTAACATTACATGTATAGCAGAAGCTCAAATCATCGGAATTGCCTTTAATCTGATACTTATCAGACCA
TGGTCTCAGAAGCAGGACCATGAAAGCGAGTTATGCAAACCACGGACTCGCTGGTTGATATGCCATAATATGCCT
TCGAATAATATAGCGCTCGGCGATGGCAACCTCCGGCTCAGACTATGCCATGATTTATAG
Gene >AgabiH39|020020
ATGGGTCATTCTTTTCCTGAAGGCCAAGTGCTGGCGCTCATGATTGGATCCATATTATATGGCCTGAACTTAGTT
ACGGTTTGGTTAACTCTTCAGCGTCTTTTCAGAGAGAGAGGAAACTGGAAACGCGGTTGGGACATCAATTTCCCT
ATGACGGCGGTCGTTATCGTACTCTTTATGGCGTCGACGACAAACTTGGCACTCCAAGTTGCTCTTGTAATGCGG
ATGTTGTCGCAGTCTCGTCCAGAGGACTTTCGGGTGGAGCGAAGTAAAATCATCGTTGCACAAGTATGCTCTCCT
GTCCTTTTTTGCGTGGTTGCGAGTGTTAATGTTCGGCCGTTTATAGGCTATCCTGTTGATTCTTGAGACGATTAT
TGCTGATGGTGTACTGGTAAGGCTTTGAAGGAATACCTTTAGAGAAATCTGACGCTCAGGTTGGTGAATTATTAA
AGCTCTTCAGATGCTGGATCGTCTGGAATAAGATGATCCTTATTATCGTCCTACCCCTGGTTCTTTGGGTGGGAT
GTGTGTCTTCTAGTGCCTACGCTAGCTACTGTTTATATCGGATCTTACTGCACCCGACGCCAGTGGCAGCTCTTG
ATCTTGGGGCAAAGACATATGCAGCCTCCGTGGCATTCTGGACTGCCACAATCACAGTGAATATCTACTGTACGG
GTAAGCCACTTATTTTGGAAATATAGCACACACTGCCATGTATAATTGTTTAGGATTGATTGTAGGGAGAATTTG
TGCCGTACAACAGGGTTGGAGACCGCCCTCCATATGTTCTTTACAGAATTTACCGCAACGAGGTCGATTGCAACT
GGCCAAACGCATAGTCATTGAGTCGGCTATGATGTACACCGTGTCATCTTTGAGTGCCTTTATCAGTCATATTTG
TCCAGTGAGCGCCGCAATTAACATTACATGTATAGCAGTGAGTCACCCGACTTTAAGGCCGATTATTTTCTTACT
AGTATGTTGAACAGGAAGCTCAAATCATCGGAATTGCCTTTAATCTGATACTTATCAGACCATGGTCTCAGAAGC
AGGACCATGAAAGCGAGTTATGCGTCAGAGGTTCTGAACCGAAGACGAAACGCTCGACAGTTAGCGTTGCGGTAG
AAACCACGGACTCGCTGGTTGATATGCCATAATATGCCTTCGAATGTGCGTCGTCGAGCACTAGTGCTTGGATAA
CAGATTGGAAAGAATGAACACCATGCCGGATAATAGAATATAGCGGTGCCCGACCTCATACTAGGTTCTTATTCT
ATCTTTGAATCACTGGAATCGTCGTAGCTCGGCGATGGCAACCTCCGGTGAGTGAGCTTCGGGCTTTGATATACT
CTTTGCTACTTTTTATTGATATCACTGTACGTTAACAGGCTCAGACTATGCCATGATTTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail