Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|019320
Gene name
Locationscaffold_10:1168791..1171410
Strand-
Gene length (bp)2619
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.6E-91 61 525
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.1E-11 534 616

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 63 629 2.0E-126
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 13 624 2.0E-107
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 15 624 1.0E-105
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 26 624 5.0E-105
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 14 624 2.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 63 629 2.0E-126
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 13 624 2.0E-107
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 15 624 1.0E-105
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 26 624 5.0E-105
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 14 624 2.0E-104
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 14 624 1.0E-103
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 14 624 1.0E-101
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 26 624 1.0E-98
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 97 623 5.0E-62
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 45 624 5.0E-58
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 41 627 1.0E-50
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 41 627 1.0E-50
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 97 624 2.0E-50
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 41 627 3.0E-49
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 94 624 2.0E-48
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 266 619 3.0E-48
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 97 622 3.0E-46
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 57 623 3.0E-46
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 45 627 5.0E-46
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 45 627 5.0E-46
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 113 632 6.0E-46
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 41 628 2.0E-45
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 94 623 9.0E-45
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 43 623 3.0E-44
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 61 627 6.0E-44
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 68 624 1.0E-42
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 93 624 1.0E-42
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 97 623 3.0E-42
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 97 624 9.0E-42
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 90 637 1.0E-41
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 51 624 2.0E-41
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 97 626 3.0E-41
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 95 623 7.0E-41
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 97 623 7.0E-41
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 95 637 1.0E-40
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 93 624 1.0E-40
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 51 624 1.0E-40
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 95 623 2.0E-40
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 51 624 2.0E-40
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 116 624 3.0E-40
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 97 622 3.0E-40
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 87 622 3.0E-40
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 95 623 2.0E-39
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 254 629 2.0E-39
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 254 629 5.0E-39
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 254 629 5.0E-39
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 254 629 1.0E-38
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 60 623 1.0E-38
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 94 624 2.0E-38
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 97 624 3.0E-38
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 97 624 4.0E-38
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 262 629 4.0E-38
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 262 629 4.0E-38
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 254 629 6.0E-38
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 108 623 6.0E-38
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 254 629 6.0E-38
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 262 629 7.0E-38
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 97 627 8.0E-38
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 262 629 1.0E-37
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 262 629 1.0E-37
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 262 629 1.0E-37
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 93 627 2.0E-37
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 93 627 8.0E-37
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 95 623 6.0E-36
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 95 623 8.0E-36
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 104 626 1.0E-35
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 95 623 1.0E-35
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 115 622 2.0E-35
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 95 623 2.0E-35
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 113 626 2.0E-35
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 46 627 2.0E-35
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 116 625 2.0E-35
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 89 623 2.0E-35
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 97 624 2.0E-35
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 95 621 4.0E-35
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 261 627 4.0E-35
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 87 624 7.0E-35
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 95 621 8.0E-35
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 114 622 1.0E-34
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 115 633 2.0E-34
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 262 616 4.0E-34
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 97 623 4.0E-34
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 95 623 8.0E-34
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 111 629 1.0E-33
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 93 627 2.0E-33
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 111 626 3.0E-33
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 46 627 4.0E-33
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 254 622 5.0E-33
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 97 624 1.0E-32
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 97 624 1.0E-32
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 95 623 1.0E-32
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 251 622 2.0E-32
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 94 632 2.0E-32
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 268 624 2.0E-32
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 114 629 3.0E-32
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 95 623 5.0E-32
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 95 623 5.0E-32
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 95 623 6.0E-32
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 95 623 6.0E-32
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 49 617 6.0E-32
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 95 623 7.0E-32
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 95 623 9.0E-32
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 95 623 9.0E-32
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 93 623 1.0E-31
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 95 623 2.0E-31
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 99 566 3.0E-31
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 95 623 3.0E-31
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 232 633 3.0E-31
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 95 623 4.0E-31
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 95 623 5.0E-31
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 254 624 5.0E-31
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 97 624 6.0E-31
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 97 624 7.0E-31
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 57 623 8.0E-31
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 57 623 8.0E-31
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 57 623 1.0E-30
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 93 623 2.0E-30
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 258 567 3.0E-30
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 95 623 3.0E-30
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 95 623 3.0E-30
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 95 624 4.0E-30
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 265 624 5.0E-30
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 252 628 6.0E-30
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 57 623 7.0E-30
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 57 623 7.0E-30
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 57 623 7.0E-30
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 50 623 7.0E-30
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 57 623 7.0E-30
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 95 623 8.0E-30
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 93 632 8.0E-30
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 97 625 1.0E-29
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 97 625 1.0E-29
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 265 624 1.0E-29
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 91 634 1.0E-29
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 97 623 1.0E-29
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 57 623 1.0E-29
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 57 623 1.0E-29
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 19 626 1.0E-29
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 101 637 2.0E-29
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 57 623 2.0E-29
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 57 623 2.0E-29
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 57 623 2.0E-29
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 57 623 2.0E-29
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 57 623 2.0E-29
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 57 623 2.0E-29
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 57 623 3.0E-29
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 57 623 3.0E-29
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 57 623 3.0E-29
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 57 623 3.0E-29
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 57 623 3.0E-29
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 93 623 4.0E-29
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 57 623 4.0E-29
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 57 623 4.0E-29
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 55 623 4.0E-29
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 98 629 9.0E-29
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 114 630 1.0E-28
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 97 631 1.0E-28
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 97 624 2.0E-28
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 57 623 2.0E-28
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 114 629 2.0E-28
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 97 624 4.0E-28
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 91 630 6.0E-28
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 98 638 8.0E-28
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 98 627 9.0E-28
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 94 624 2.0E-27
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 57 623 2.0E-27
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 97 539 7.0E-27
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 93 622 1.0E-26
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 260 553 1.0E-26
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 105 624 3.0E-26
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 264 630 3.0E-26
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 57 583 3.0E-26
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 260 624 4.0E-26
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 241 624 5.0E-26
sp|A0R3D6|Y5435_MYCS2 Putative ligase MSMEG_5435/MSMEI_5285 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5435 PE=1 SV=1 244 553 1.0E-25
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 95 629 3.0E-25
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 97 619 4.0E-25
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 93 623 5.0E-25
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 115 624 1.0E-24
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 97 623 2.0E-24
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 88 539 2.0E-24
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 261 628 2.0E-24
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 99 573 5.0E-24
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 97 624 6.0E-24
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 139 632 8.0E-24
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 64 624 1.0E-23
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 98 629 1.0E-23
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 97 624 1.0E-23
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 93 624 1.0E-23
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 97 623 2.0E-23
sp|Q14DH7|ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus GN=Acss3 PE=1 SV=2 96 622 2.0E-23
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 253 613 2.0E-23
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 97 627 3.0E-23
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 97 624 6.0E-23
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 97 624 8.0E-23
sp|Q7A1Q0|VRAA_STAAW Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain MW2) GN=vraA PE=3 SV=1 262 619 1.0E-22
sp|Q6GBR2|VRAA_STAAS Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain MSSA476) GN=vraA PE=3 SV=1 262 619 1.0E-22
sp|Q7A769|VRAA_STAAN Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain N315) GN=vraA PE=3 SV=1 262 619 1.0E-22
sp|Q99W34|VRAA_STAAM Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraA PE=3 SV=1 262 619 1.0E-22
sp|Q5HIA1|VRAA_STAAC Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain COL) GN=vraA PE=3 SV=1 262 619 1.0E-22
sp|Q9KWK5|VRAA_STAA1 Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraA PE=3 SV=3 262 619 1.0E-22
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 97 624 1.0E-22
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 268 622 1.0E-22
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 97 624 2.0E-22
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 97 627 2.0E-22
sp|Q9SFW5|AEE21_ARATH Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 87 630 3.0E-22
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 97 624 3.0E-22
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 95 624 3.0E-22
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 97 627 3.0E-22
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 252 622 3.0E-22
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 252 622 3.0E-22
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 59 540 4.0E-22
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 268 622 5.0E-22
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 268 622 5.0E-22
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 97 627 5.0E-22
sp|Q6GJ94|VRAA_STAAR Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus aureus (strain MRSA252) GN=vraA PE=3 SV=1 263 619 6.0E-22
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 97 623 6.0E-22
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 258 628 6.0E-22
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 97 627 7.0E-22
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 98 627 7.0E-22
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 54 624 7.0E-22
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 252 622 8.0E-22
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 97 624 9.0E-22
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 84 551 9.0E-22
sp|Q9H6R3|ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1 97 622 1.0E-21
sp|Q72J95|ACSA_THET2 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 97 624 1.0E-21
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 55 631 1.0E-21
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 97 622 1.0E-21
sp|Q5REB8|ACSS3_PONAB Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii GN=ACSS3 PE=2 SV=1 97 622 2.0E-21
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 252 622 2.0E-21
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 252 622 2.0E-21
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 252 622 2.0E-21
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 252 622 2.0E-21
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 252 622 2.0E-21
sp|Q5HRH4|VRAA_STAEQ Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=vraA PE=3 SV=1 263 619 2.0E-21
sp|Q5SIW6|ACSA_THET8 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 97 624 2.0E-21
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 42 536 3.0E-21
sp|Q7N7A9|AAS_PHOLL Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 61 526 3.0E-21
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 97 627 4.0E-21
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 94 622 4.0E-21
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 268 622 4.0E-21
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 97 624 4.0E-21
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 268 628 5.0E-21
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 259 616 5.0E-21
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 259 616 5.0E-21
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 259 616 5.0E-21
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 259 616 5.0E-21
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 252 622 6.0E-21
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 72 623 7.0E-21
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 252 622 7.0E-21
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 252 622 7.0E-21
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 252 622 7.0E-21
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 252 622 7.0E-21
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 252 622 7.0E-21
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 252 622 7.0E-21
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 97 627 9.0E-21
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 259 616 1.0E-20
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 97 624 1.0E-20
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 259 616 1.0E-20
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 259 616 1.0E-20
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 97 623 1.0E-20
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 260 624 1.0E-20
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 261 619 2.0E-20
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 240 616 2.0E-20
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 261 619 2.0E-20
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 61 628 2.0E-20
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 97 626 2.0E-20
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 252 622 3.0E-20
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 268 616 3.0E-20
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 268 616 3.0E-20
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 261 628 3.0E-20
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 261 625 4.0E-20
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 97 539 4.0E-20
sp|Q8CQ67|VRAA_STAES Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=vraA PE=3 SV=1 262 582 5.0E-20
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 232 622 6.0E-20
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 97 624 6.0E-20
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 97 539 6.0E-20
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 240 616 7.0E-20
sp|Q8GVF9|4CLL8_ORYSJ Putative 4-coumarate--CoA ligase-like 8 OS=Oryza sativa subsp. japonica GN=4CLL8 PE=3 SV=1 256 624 8.0E-20
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 97 624 9.0E-20
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 97 622 1.0E-19
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 97 624 1.0E-19
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 97 626 1.0E-19
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 261 625 2.0E-19
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 97 624 2.0E-19
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 97 623 2.0E-19
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 260 624 2.0E-19
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 269 623 2.0E-19
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 97 627 2.0E-19
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 210 551 3.0E-19
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 336 623 3.0E-19
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 99 562 3.0E-19
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 116 551 3.0E-19
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 250 628 3.0E-19
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 250 628 3.0E-19
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 97 624 4.0E-19
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 250 631 6.0E-19
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 250 631 6.0E-19
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 97 622 7.0E-19
sp|Q4L3Q0|VRAA_STAHJ Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraA PE=3 SV=1 254 632 7.0E-19
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 97 623 7.0E-19
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 261 628 8.0E-19
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 266 628 8.0E-19
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 262 622 8.0E-19
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 97 624 9.0E-19
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 250 628 9.0E-19
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 250 628 9.0E-19
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 250 628 9.0E-19
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 16 536 1.0E-18
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 97 628 1.0E-18
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 97 624 1.0E-18
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 268 631 1.0E-18
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 250 628 1.0E-18
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 250 628 1.0E-18
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 97 623 2.0E-18
sp|A7MB45|ACSS3_BOVIN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus GN=ACSS3 PE=2 SV=1 97 622 2.0E-18
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 411 623 2.0E-18
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 240 625 2.0E-18
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 240 625 2.0E-18
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 97 624 2.0E-18
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 250 628 2.0E-18
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 250 628 2.0E-18
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 250 628 2.0E-18
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 250 628 2.0E-18
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 251 551 3.0E-18
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 268 557 3.0E-18
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 99 562 3.0E-18
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 59 569 3.0E-18
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 240 625 3.0E-18
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 97 624 3.0E-18
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 97 623 3.0E-18
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 97 623 3.0E-18
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 44 558 4.0E-18
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 64 632 4.0E-18
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 55 631 4.0E-18
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 55 631 4.0E-18
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 55 631 4.0E-18
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 240 625 4.0E-18
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 95 530 4.0E-18
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 240 625 4.0E-18
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 240 625 4.0E-18
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 240 625 4.0E-18
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 97 624 4.0E-18
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 97 624 4.0E-18
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 97 624 4.0E-18
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 97 624 4.0E-18
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 240 625 4.0E-18
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 240 625 5.0E-18
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 240 625 5.0E-18
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 240 625 5.0E-18
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 240 625 5.0E-18
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 240 625 5.0E-18
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 240 625 5.0E-18
sp|A6VZN8|ACSA_MARMS Acetyl-coenzyme A synthetase OS=Marinomonas sp. (strain MWYL1) GN=acsA PE=3 SV=1 97 624 5.0E-18
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 97 624 7.0E-18
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 97 624 7.0E-18
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 251 628 7.0E-18
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 97 624 8.0E-18
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 97 624 8.0E-18
sp|Q1CUA3|ACSA_HELPH Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 113 628 8.0E-18
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 97 622 8.0E-18
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 97 624 8.0E-18
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 251 551 1.0E-17
sp|O14975|S27A2_HUMAN Very long-chain acyl-CoA synthetase OS=Homo sapiens GN=SLC27A2 PE=1 SV=2 62 555 1.0E-17
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 97 624 1.0E-17
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 97 637 1.0E-17
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 97 632 1.0E-17
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 40 622 2.0E-17
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 97 624 2.0E-17
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 97 624 2.0E-17
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 20 536 2.0E-17
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 97 624 2.0E-17
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 97 624 2.0E-17
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 97 624 2.0E-17
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 268 616 2.0E-17
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 268 622 2.0E-17
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 268 622 2.0E-17
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 97 622 3.0E-17
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 268 622 3.0E-17
sp|P97524|S27A2_RAT Very long-chain acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a2 PE=1 SV=1 62 568 3.0E-17
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 268 622 4.0E-17
sp|O25686|ACSA_HELPY Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acsA PE=3 SV=1 113 628 4.0E-17
sp|B6JKX8|ACSA_HELP2 Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain P12) GN=acsA PE=3 SV=1 113 628 4.0E-17
sp|B5Z6E9|ACSA_HELPG Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain G27) GN=acsA PE=3 SV=1 113 628 4.0E-17
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 97 624 5.0E-17
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 97 624 5.0E-17
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 97 624 5.0E-17
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 268 622 6.0E-17
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 97 623 6.0E-17
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 99 628 7.0E-17
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 97 624 8.0E-17
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 97 624 8.0E-17
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 64 624 8.0E-17
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 97 624 8.0E-17
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 97 624 8.0E-17
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 268 622 8.0E-17
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 97 632 9.0E-17
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 97 632 9.0E-17
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 97 635 9.0E-17
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 92 588 1.0E-16
sp|Q17WR1|ACSA_HELAH Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 91 623 1.0E-16
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 97 624 1.0E-16
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 97 624 1.0E-16
sp|P19409|BAIB_CLOSV Bile acid-coenzyme A ligase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiB PE=1 SV=1 244 600 1.0E-16
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 260 624 2.0E-16
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 97 635 2.0E-16
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 97 635 2.0E-16
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 97 635 2.0E-16
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 97 635 2.0E-16
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 97 635 2.0E-16
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 97 635 2.0E-16
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 95 624 2.0E-16
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 97 624 2.0E-16
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 97 624 2.0E-16
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 97 635 2.0E-16
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 268 622 2.0E-16
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 97 624 2.0E-16
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 97 624 3.0E-16
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 97 624 3.0E-16
sp|Q73ZP7|MBTM_MYCPA Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtM PE=3 SV=1 266 624 3.0E-16
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 97 624 3.0E-16
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 229 616 4.0E-16
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 97 624 4.0E-16
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 97 627 5.0E-16
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 97 627 5.0E-16
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 97 632 5.0E-16
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 29 536 5.0E-16
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 224 634 5.0E-16
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 97 624 6.0E-16
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 97 627 6.0E-16
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 64 624 7.0E-16
sp|P37418|MENE_SALTY 2-succinylbenzoate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menE PE=3 SV=2 259 628 7.0E-16
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 97 624 7.0E-16
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 97 623 7.0E-16
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 97 635 7.0E-16
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 97 637 8.0E-16
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 97 624 8.0E-16
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 97 624 8.0E-16
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 97 624 1.0E-15
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 97 624 1.0E-15
sp|Q92KX2|ACSA_RHIME Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 97 637 1.0E-15
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 50 623 1.0E-15
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 243 622 2.0E-15
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 268 629 2.0E-15
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 97 637 2.0E-15
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 236 622 2.0E-15
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 97 624 2.0E-15
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 97 624 2.0E-15
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 97 624 2.0E-15
sp|P38225|FAT1_YEAST Very long-chain fatty acid transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAT1 PE=1 SV=2 112 624 2.0E-15
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 92 627 2.0E-15
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 92 627 2.0E-15
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 237 622 3.0E-15
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 97 624 3.0E-15
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 92 627 3.0E-15
sp|P54200|FAD21_MYCLE Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium leprae (strain TN) GN=fadD21 PE=3 SV=2 266 628 3.0E-15
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 97 632 4.0E-15
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 64 624 4.0E-15
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 97 624 4.0E-15
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 261 622 5.0E-15
sp|B9JEV4|ACSA_AGRRK Acetyl-coenzyme A synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=acsA PE=3 SV=1 97 635 5.0E-15
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 92 588 5.0E-15
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 97 624 5.0E-15
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 97 624 5.0E-15
sp|B9DGD6|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 97 633 6.0E-15
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 377 541 6.0E-15
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 377 541 6.0E-15
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 97 624 6.0E-15
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 97 623 6.0E-15
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 97 624 6.0E-15
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 97 637 6.0E-15
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 64 624 7.0E-15
sp|P44565|MENE_HAEIN 2-succinylbenzoate--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menE PE=3 SV=1 266 560 7.0E-15
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 97 624 7.0E-15
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 97 637 8.0E-15
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 97 624 8.0E-15
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 94 619 9.0E-15
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 94 619 9.0E-15
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 97 624 1.0E-14
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 92 588 1.0E-14
sp|Q1BBA2|MBTM_MYCSS Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium sp. (strain MCS) GN=mbtM PE=3 SV=1 259 619 1.0E-14
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 97 624 1.0E-14
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 97 624 1.0E-14
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 97 624 1.0E-14
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 113 627 1.0E-14
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 261 622 7.0E-14
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 268 622 8.0E-14
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 254 622 2.0E-13
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 94 622 2.0E-13
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 266 622 2.0E-13
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 268 622 2.0E-13
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 268 622 2.0E-13
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 236 622 5.0E-13
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 236 622 5.0E-13
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 233 622 7.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 237 617 7.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 261 617 1.0E-12
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 268 569 4.0E-12
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 268 628 6.0E-12
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 268 622 7.0E-12
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 266 622 1.0E-11
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 266 622 1.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 244 622 1.0E-11
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 268 560 2.0E-11
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 268 622 3.0E-11
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 268 627 1.0E-10
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 97 619 2.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 268 634 5.0E-10
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 268 622 8.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 266 619 1.0E-09
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 261 622 1.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 268 627 1.0E-09
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 268 627 2.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 260 633 3.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 261 622 2.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 260 622 6.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 411 622 9.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 268 622 1.0E-06
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 268 622 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup6653
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|019320 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|019320
Rhodonia placenta FPRL280 RhoplFPRL280|19_44

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|019320
MHVLFRTTICSGPFLRSLSTRAASTLPLNGSLLTQSAVAGPTEPPLSAKTLPQYFAEDVLARYPSRPALICRQEA
PRSHAGPPSRNFKDVSYLAWDYEEFDRHIQALARGLLEMGVKKGDRVGVIMGNNSAYAMLQWACASIGAILATIN
PAYKLQELVDTLRLVGAKHLVAVPRIRSSTYIETFSQAFPQIRSQHPGEIQIEELPELRNLIVVDNAEEDRARLE
RLKIKSLVDWREILLWRDDTIEGRKLNEIRSGLEKDEVINLQFTSGTTGLPKAVSLTHSNLLNNGLSIGRSMWFS
EQDILCNTPPLFHCFGLVLGNLATWTHGACIVYPSPTFDPAAVVDTVTEEKCTALHGVPTHFLGILAEAERRKAS
GELFNFETLRTGIAAGSPIPIDLMKTLVAKLNLRDLTVAYGMTETSPVSFQSTPADPLIKRVETVGKIMPHTKAK
VVDKDEKIVPVGTPGEIIVAGYLLQKGYWNEEVQTKQVMKKDEEGTLWMSTGDEGIMDEEGYLRIVGRIKDIIIR
GGENLFPVQIENALTAHDSIREAAVVSVPDPKYGEVVGAWIIRETGKDVIEREEVRMSVAQTMNPQNAPAWVWFI
GEDVTVTELPKTASGKVQKHILRQWSREIAEKGVGKVR*
Coding >AgabiH39|019320
ATGCACGTCCTTTTTCGTACAACCATCTGCTCCGGACCATTTCTACGGTCGCTTTCAACTAGAGCAGCTTCAACG
CTACCGTTAAATGGTTCTTTGTTAACCCAATCGGCTGTAGCTGGCCCGACAGAACCTCCTCTCTCAGCAAAAACA
CTCCCACAATATTTTGCAGAGGATGTTCTTGCGCGTTACCCTTCCCGTCCGGCTCTCATATGTCGTCAAGAAGCT
CCGCGTTCTCATGCGGGACCCCCCTCTCGCAATTTCAAGGACGTTTCATACTTGGCTTGGGATTATGAGGAATTT
GATAGGCATATACAGGCGTTAGCTCGGGGTCTGCTTGAGATGGGCGTGAAGAAAGGAGACAGGGTAGGTGTCATC
ATGGGGAACAACAGTGCATATGCCATGTTACAGTGGGCATGCGCCAGTATTGGTGCTATACTCGCAACCATAAAT
CCTGCGTACAAGTTACAAGAGCTCGTCGACACGCTGCGACTTGTTGGTGCAAAACATCTGGTGGCCGTTCCCCGT
ATCCGATCATCCACGTACATCGAAACATTCTCTCAAGCGTTCCCTCAAATTCGATCCCAACACCCCGGCGAAATT
CAAATCGAAGAACTTCCAGAACTTCGGAATTTGATCGTTGTGGATAATGCAGAAGAAGACCGTGCACGACTCGAA
AGACTGAAGATAAAAAGTCTGGTTGACTGGAGGGAGATTTTGCTGTGGAGGGATGATACAATCGAAGGAAGGAAG
TTGAACGAGATCAGGAGTGGTTTGGAGAAGGATGAAGTTATCAACTTGCAATTTACAAGTGGGACAACGGGGCTT
CCAAAAGCAGTTTCGCTTACGCATTCCAATCTTCTTAACAATGGACTCAGTATCGGTCGAAGTATGTGGTTTTCA
GAGCAAGATATCTTATGTAACACGCCTCCACTCTTCCACTGTTTTGGCCTCGTCCTTGGAAATTTAGCAACATGG
ACTCATGGCGCTTGCATTGTATATCCTTCCCCCACTTTCGACCCCGCTGCGGTTGTAGACACTGTAACGGAAGAA
AAGTGTACTGCACTGCATGGCGTACCAACACACTTCTTAGGTATTTTAGCAGAAGCTGAGAGGCGTAAAGCCTCC
GGTGAACTGTTTAACTTCGAAACGTTAAGGACTGGCATCGCTGCGGGGTCACCCATACCTATTGATCTTATGAAA
ACTTTGGTGGCCAAATTGAATTTGAGGGATTTAACAGTCGCTTATGGAATGACTGAGACGAGTCCCGTCTCTTTC
CAATCAACTCCTGCCGATCCACTGATCAAACGTGTTGAGACTGTTGGAAAAATTATGCCTCACACAAAAGCAAAA
GTCGTGGACAAAGACGAGAAGATTGTACCTGTAGGTACACCAGGTGAGATTATTGTAGCTGGATATCTTTTGCAA
AAAGGATATTGGAATGAAGAAGTTCAAACGAAACAAGTAATGAAGAAGGATGAGGAAGGAACGTTATGGATGTCG
ACTGGTGATGAAGGAATCATGGATGAGGAAGGATATCTCAGGATTGTCGGTAGAATAAAGGATATCATTATCCGC
GGTGGCGAGAATTTGTTCCCCGTTCAAATCGAGAATGCATTAACGGCTCATGATTCAATACGAGAAGCAGCCGTA
GTTTCGGTTCCAGATCCGAAGTATGGCGAGGTTGTAGGAGCATGGATTATTCGCGAAACAGGGAAGGACGTTATC
GAGAGAGAGGAAGTAAGAATGTCTGTTGCGCAGACTATGAATCCTCAGAACGCTCCCGCATGGGTTTGGTTTATC
GGTGAAGACGTCACTGTAACTGAGTTGCCTAAAACTGCGAGCGGAAAAGTTCAGAAGCATATCTTGAGGCAGTGG
AGTCGTGAGATTGCTGAGAAAGGCGTTGGTAAAGTGCGGTGA
Transcript >AgabiH39|019320
ATGCACGTCCTTTTTCGTACAACCATCTGCTCCGGACCATTTCTACGGTCGCTTTCAACTAGAGCAGCTTCAACG
CTACCGTTAAATGGTTCTTTGTTAACCCAATCGGCTGTAGCTGGCCCGACAGAACCTCCTCTCTCAGCAAAAACA
CTCCCACAATATTTTGCAGAGGATGTTCTTGCGCGTTACCCTTCCCGTCCGGCTCTCATATGTCGTCAAGAAGCT
CCGCGTTCTCATGCGGGACCCCCCTCTCGCAATTTCAAGGACGTTTCATACTTGGCTTGGGATTATGAGGAATTT
GATAGGCATATACAGGCGTTAGCTCGGGGTCTGCTTGAGATGGGCGTGAAGAAAGGAGACAGGGTAGGTGTCATC
ATGGGGAACAACAGTGCATATGCCATGTTACAGTGGGCATGCGCCAGTATTGGTGCTATACTCGCAACCATAAAT
CCTGCGTACAAGTTACAAGAGCTCGTCGACACGCTGCGACTTGTTGGTGCAAAACATCTGGTGGCCGTTCCCCGT
ATCCGATCATCCACGTACATCGAAACATTCTCTCAAGCGTTCCCTCAAATTCGATCCCAACACCCCGGCGAAATT
CAAATCGAAGAACTTCCAGAACTTCGGAATTTGATCGTTGTGGATAATGCAGAAGAAGACCGTGCACGACTCGAA
AGACTGAAGATAAAAAGTCTGGTTGACTGGAGGGAGATTTTGCTGTGGAGGGATGATACAATCGAAGGAAGGAAG
TTGAACGAGATCAGGAGTGGTTTGGAGAAGGATGAAGTTATCAACTTGCAATTTACAAGTGGGACAACGGGGCTT
CCAAAAGCAGTTTCGCTTACGCATTCCAATCTTCTTAACAATGGACTCAGTATCGGTCGAAGTATGTGGTTTTCA
GAGCAAGATATCTTATGTAACACGCCTCCACTCTTCCACTGTTTTGGCCTCGTCCTTGGAAATTTAGCAACATGG
ACTCATGGCGCTTGCATTGTATATCCTTCCCCCACTTTCGACCCCGCTGCGGTTGTAGACACTGTAACGGAAGAA
AAGTGTACTGCACTGCATGGCGTACCAACACACTTCTTAGGTATTTTAGCAGAAGCTGAGAGGCGTAAAGCCTCC
GGTGAACTGTTTAACTTCGAAACGTTAAGGACTGGCATCGCTGCGGGGTCACCCATACCTATTGATCTTATGAAA
ACTTTGGTGGCCAAATTGAATTTGAGGGATTTAACAGTCGCTTATGGAATGACTGAGACGAGTCCCGTCTCTTTC
CAATCAACTCCTGCCGATCCACTGATCAAACGTGTTGAGACTGTTGGAAAAATTATGCCTCACACAAAAGCAAAA
GTCGTGGACAAAGACGAGAAGATTGTACCTGTAGGTACACCAGGTGAGATTATTGTAGCTGGATATCTTTTGCAA
AAAGGATATTGGAATGAAGAAGTTCAAACGAAACAAGTAATGAAGAAGGATGAGGAAGGAACGTTATGGATGTCG
ACTGGTGATGAAGGAATCATGGATGAGGAAGGATATCTCAGGATTGTCGGTAGAATAAAGGATATCATTATCCGC
GGTGGCGAGAATTTGTTCCCCGTTCAAATCGAGAATGCATTAACGGCTCATGATTCAATACGAGAAGCAGCCGTA
GTTTCGGTTCCAGATCCGAAGTATGGCGAGGTTGTAGGAGCATGGATTATTCGCGAAACAGGGAAGGACGTTATC
GAGAGAGAGGAAGTAAGAATGTCTGTTGCGCAGACTATGAATCCTCAGAACGCTCCCGCATGGGTTTGGTTTATC
GGTGAAGACGTCACTGTAACTGAGTTGCCTAAAACTGCGAGCGGAAAAGTTCAGAAGCATATCTTGAGGCAGTGG
AGTCGTGAGATTGCTGAGAAAGGCGTTGGTAAAGTGCGGTGA
Gene >AgabiH39|019320
ATGCACGTCCTTTTTCGTACAACCATCTGCTCCGGACCATTTCTACGGTCGCTTTCAACTAGAGCAGCTTCAACG
CTACCGTTAAATGGTTCTTTGTTAACCCAATCGGCTGTAGCTGGCCCGACAGAACCTCCTCTCTCAGCAAAAACA
CTCCCACAATATTTTGCAGAGGATGTTCTTGCGCGTTACCCTTCCCGTCCGGCTCTCATATGTCGTCAAGAAGCT
CCGCGTTCTCATGCGGGACCCCCCTCTCGCAATTTCAAGGACGTTTCATACTTGGCTTGGGATTATGAGGAATTT
GATAGGCATATACAGGCGTTAGCTCGGGGTCTGCTTGAGATGGGCGTGAAGAAAGGAGACAGGGTAGGTGTCATC
ATGGGGAACAACAGGTGAGTACTGATCGAACGAGTTCGGTGTCTTTTGAATTTTGAACCAATCCACAGTGCATAT
GCCATGTTACAGTGGGCATGCGCCAGTATTGGTGCTATACTCGCAACCATAAATCCTGCGTACAAGTTACAAGAG
CTCGTGCGTCGACGGTTGAAAGTACCACTCAAAGTTTTCGTACTGACCTCTTAATAATAGGTCGACACGCTGCGA
CTTGTTGGTGCAAAACATCTGGTGGCCGTTCCCCGTATCCGATCATCCACGTACATCGAAACATTCTCTCAAGCG
TTCCCTCAAATTCGATCCCAACACCCCGGCGAAATTCAAATCGAAGAACTTCCAGAACTTCGGAATTTGATCGTT
GTGGATAATGCAGAAGAAGACCGTGCACGACTCGAAAGACTGAAGATAAAAAGTCTGGTTGACTGGAGGGAGATT
TTGCTGTGGAGGGATGATACAATCGAAGGAAGGAAGTTGAACGAGATCAGGAGTGGTTTGGAGAAGGATGAAGTT
ATCAACTTGCAATTTACAAGGTAAATTGTTGATTCTGGTGTTGAACGATCTCTCATACCACCCTTACCAGTGGGA
CAACGGGGCTTCCAAAAGCAGTTTCGGTATGTGAATCTCCAACCCAAGCCGAAGAAATAGGTCAACATAAAGTTT
AGCTTACGCATTCCAATCTTCTTAACAATGGACTCAGTATCGGTCGAAGTATGTGGTTTTCAGAGCAAGATATCT
TATGTACGTCCTCCGACTAGGATTTCTCAGAATTTGCCCTGATGATTTTTTTTTCAGGTAACACGCCTCCACTCT
TCCACTGTTTTGATGAGTGCAGCATTTCCTCCGATCATGCTGTCCTAGTAGACTGATAATCTCTTTTCTCATGAA
CACGCCTCGTCCTTGGAAATTTAGCAACATGGACTCATGGCGCTTGCATTGTATATCCTTCCCCCACTTTCGACC
CCGCTGCGGTTGTAGACACTGTAACGGAAGAAAAGTGTACTGCACTGCATGGCGTACCAACACACTTCTTAGGTA
TTTTAGCAGAAGCTGAGAGGCGTAAAGCCTCCGGTGAACTGTTTAACTTCGAAACGTTAAGGTGCGCACTCTTAG
AAACATGATTTCAATTAGTTCTAAGACTATTTTGTGGCAGGACTGGCATCGCTGCGGGGTCACCCATACCTATTG
ATCTTATGAAAACTTTGGTGGCCAAATTGAATTTGAGGGATTTAACAGTCGCTTATGGAATGAGTGGGTGCTTTA
TCTTCAAAATATCCTCTCTGTGAACTGGACGAATCGTTCTTTACTACCTTTTCGACAGCTGAGACGAGTCCCGTC
TCTTTCCAATCAACTCCTGCCGATCCACTGATCAAACGTGTTGAGACTGTTGGAAAAATTATGCCTCACACAAAA
GCAAAAGTCGTGGACAAAGACGAGAAGATTGTACCTGTAGGTACACCAGGTGAGATTATTGTAGCTGGATATCTT
TTGCAAAAAGGGTCAGTTGTTCATGTGGATGCTTGATTTATTCATTCATTCATTGACGCGGTGGTACTTTATAGA
TATTGGAATGAAGAAGTTCAAACGAAACAAGTAATGAAGAAGGATGAGGAAGGAACGTTATGGATGTCGACTGGT
GATGAAGGAATCATGGATGAGGAAGGATATCTCAGGAGTGAGTATTCTTTTATGGTAATGTTTGAGGCTATGAAG
GCTGAACGACTAAATCTGCTTCACTAGTTGTCGGTAGAATAAAGGATATCATTATCCGCGGTGGCGAGGTATGAG
ATTTTATTATCAGTACAAAAGCAGTCTGCTCATTGTCAATTGAAGAATTTGTTCCCCGTTCAAATCGAGAATGCA
TTAACGGCTCATGATTCAATACGAGAAGCAGCCGTAGTTTCGGTTCCAGATCCGAAGTATGGCGAGGTTGTAGGA
GCATGGATTATTCGCGAAACAGGGAAGGACGTTATCGAGAGAGAGGAAGTAAGAATGTCTGTTGCGCAGACTATG
AATCCTCAGGTAAGTGTATTATTCTTGCGTGGCAAACTTGATGAAATATTTTCTATTATTCCACCCCTTTGGTAG
AACGCTCCCGCATGGGTTTGGTTTATCGGTGAAGACGTCACTGTAACTGAGTTGCCTAAAACTGCGAGCGGAAAA
GTTCAGAAGCATATCTTGAGGCAGTGGAGTCGTGAGATTGCTGAGAAAGGCGTTGGTAAAGTGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail