Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|017900
Gene name
Locationscaffold_10:813191..814677
Strand+
Gene length (bp)1486
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999777

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3408
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|017900 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|017900
Rhodonia placenta FPRL280 RhoplFPRL280|16_12

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|017900
MPAKFVLASLLLASLSSVVSAASSCIASDIHWNLLAFGFNGKDYDAGTQDSWTQGNATDITTTQGRPPFDGSNVT
CYLSQFTNAIYFMGADASKPNDIHIYDATAKSWSTQAVQQNSFDPTSSGAILDHDTNVFYAYSGGDIYSLDMELL
KAANSTPKAWNDVQKVDWDTSSYQPTVALGQNHIFFLGVPGVNPGSTRIFVIHFSYLQPEPQAFGDIPNMHGKTA
SIFKDEGVQTQFIYVPDDGSATYLLDVTSNTTQTLKAPMNKDAQATYFATTTAVIQLSSSGSVSYLPIDATNEGA
NSNSNWATVSNLPVATPAKPSSASGSASGTGSAGAQSTGSTSDGTMDNGAAVLNVGRWVWSAVALMVGAALF*
Coding >AgabiH39|017900
ATGCCTGCAAAATTCGTCCTTGCTTCCCTCCTTCTTGCCTCGCTCTCTTCTGTAGTATCGGCCGCCTCCTCCTGC
ATCGCATCCGACATCCACTGGAACCTTCTCGCCTTCGGTTTCAATGGCAAGGACTATGACGCTGGCACCCAGGAT
TCCTGGACTCAAGGGAATGCCACGGATATAACAACAACTCAAGGCCGACCCCCTTTCGATGGCTCAAACGTCACC
TGCTATCTGTCACAATTCACAAATGCAATTTATTTCATGGGGGCCGACGCTTCTAAACCTAACGACATCCACATC
TATGATGCCACTGCGAAATCTTGGTCCACCCAAGCTGTACAGCAGAACTCTTTTGATCCAACTAGTTCTGGCGCT
ATCCTTGACCATGACACCAACGTATTCTACGCGTATTCCGGGGGAGACATCTATTCTCTTGATATGGAGCTCCTC
AAGGCAGCTAACAGTACCCCAAAGGCGTGGAATGACGTCCAGAAAGTCGATTGGGATACCTCCAGTTATCAACCC
ACTGTGGCATTGGGCCAGAACCACATCTTTTTCCTAGGAGTTCCGGGAGTAAACCCTGGAAGTACCAGAATTTTT
GTTATCCACTTCTCATACTTGCAGCCCGAACCCCAAGCTTTCGGAGACATCCCAAACATGCATGGTAAAACTGCT
TCTATTTTCAAAGACGAAGGTGTTCAAACCCAATTCATCTATGTCCCTGATGATGGCTCAGCTACTTATCTGCTT
GACGTCACGAGCAACACCACACAGACATTGAAAGCTCCCATGAACAAGGATGCCCAGGCGACTTATTTTGCCACA
ACGACTGCTGTCATCCAACTTTCGTCGTCTGGCTCTGTTTCTTATCTTCCAATCGATGCGACCAACGAGGGTGCC
AATTCTAATTCCAACTGGGCGACTGTCAGTAATTTGCCGGTGGCGACTCCAGCCAAGCCGTCTTCTGCTTCTGGT
TCTGCTTCGGGCACCGGAAGTGCCGGAGCTCAAAGTACTGGCTCGACTTCAGATGGTACGATGGACAATGGTGCT
GCAGTTCTGAATGTTGGACGTTGGGTGTGGAGTGCCGTTGCACTCATGGTCGGAGCAGCGCTCTTCTAA
Transcript >AgabiH39|017900
ATGCCTGCAAAATTCGTCCTTGCTTCCCTCCTTCTTGCCTCGCTCTCTTCTGTAGTATCGGCCGCCTCCTCCTGC
ATCGCATCCGACATCCACTGGAACCTTCTCGCCTTCGGTTTCAATGGCAAGGACTATGACGCTGGCACCCAGGAT
TCCTGGACTCAAGGGAATGCCACGGATATAACAACAACTCAAGGCCGACCCCCTTTCGATGGCTCAAACGTCACC
TGCTATCTGTCACAATTCACAAATGCAATTTATTTCATGGGGGCCGACGCTTCTAAACCTAACGACATCCACATC
TATGATGCCACTGCGAAATCTTGGTCCACCCAAGCTGTACAGCAGAACTCTTTTGATCCAACTAGTTCTGGCGCT
ATCCTTGACCATGACACCAACGTATTCTACGCGTATTCCGGGGGAGACATCTATTCTCTTGATATGGAGCTCCTC
AAGGCAGCTAACAGTACCCCAAAGGCGTGGAATGACGTCCAGAAAGTCGATTGGGATACCTCCAGTTATCAACCC
ACTGTGGCATTGGGCCAGAACCACATCTTTTTCCTAGGAGTTCCGGGAGTAAACCCTGGAAGTACCAGAATTTTT
GTTATCCACTTCTCATACTTGCAGCCCGAACCCCAAGCTTTCGGAGACATCCCAAACATGCATGGTAAAACTGCT
TCTATTTTCAAAGACGAAGGTGTTCAAACCCAATTCATCTATGTCCCTGATGATGGCTCAGCTACTTATCTGCTT
GACGTCACGAGCAACACCACACAGACATTGAAAGCTCCCATGAACAAGGATGCCCAGGCGACTTATTTTGCCACA
ACGACTGCTGTCATCCAACTTTCGTCGTCTGGCTCTGTTTCTTATCTTCCAATCGATGCGACCAACGAGGGTGCC
AATTCTAATTCCAACTGGGCGACTGTCAGTAATTTGCCGGTGGCGACTCCAGCCAAGCCGTCTTCTGCTTCTGGT
TCTGCTTCGGGCACCGGAAGTGCCGGAGCTCAAAGTACTGGCTCGACTTCAGATGGTACGATGGACAATGGTGCT
GCAGTTCTGAATGTTGGACGTTGGGTGTGGAGTGCCGTTGCACTCATGGTCGGAGCAGCGCTCTTCTAA
Gene >AgabiH39|017900
ATGCCTGCAAAATTCGTCCTTGCTTCCCTCCTTCTTGCCTCGCTCTCTTCTGTAGTATCGGCCGCCTCCTCCTGC
ATCGCATCCGACATCCACTGGAACCTTCTCGCCTTCGGTTTCAATGGCAAGGACTATGACGCTGGCACCCAGGAT
TCCTGGACTCAAGGTAAGCAATATATGTTCTCTCATATCTCTTTTTCCATGTGTTAAAAATTTTCTCAGGGAATG
CCACGGATATAACAACAACTCAAGGCCGACCGTAAGTCACCACCAAATATCTGTCCATCCCACCAACGTCAAACC
CATTTTAGCCCTTTCGATGGCTCAAACGTCACCTGCTATCTGTCACAAGTCAGCCCACCTATATTTTCATAATCC
GAATGCTGACATTAGCACCGGCAGTTCACAAATGCAATTTATTTCATGGGGGCCGACGCTTCTAAACCTAACGAC
ATCCACATCTATGATGCCACTGCGAAATCTTGGTCCACCCAAGCTGTACAGCAGAACTCTTTTGATCCAACTAGT
TCTGGCGCTATCCTTGACCATGACACCAACGTATTCTGTACGTAGTCTTTTCTCAATTTTATGAACTTGCTTAAT
TCGAAATTCAGACGCGTATTCCGGGGGAGACATCTATTCTCTTGATATGGAGCTCCTCAAGGCAGCTAACAGTAC
CCCAAAGGCGTGGAATGACGTCCAGAAAGTCGATTGGGATACCTCCAGTTATCAACCCACTGTGGCATTGGGCCA
GAACCACATCTTTTTCCTAGGAGTTCCGGGAGTAAACCCTGGAAGTACCAGAATTTTTGTTATCCACTGTGTGTT
TCTTTGGTTAGGTGACTGTGACCTTCGATAATCTGATTGTTCTCCTAGTCTCATACTTGCAGCCCGAACCCCAAG
CTTTCGGAGACATCCCAAACATGCATGGTAAAACTGCTTCTATTTTCAAAGACGAAGGTGTCAGTGGCAAACTAG
TTATTTCACTCACGTAGTTTCTGATCGATTACCAGGTTCAAACCCAATTCATCTATGTCCCTGATGATGGCTCAG
CTACTTATCTGCTTGACGTCACGGTATGATGGTTCCACCCCGCACTGGCAAAGTGAATTAATCACCGCCTCCGCA
GAGCAACACCACACAGACATTGAAAGCTCCCATGAACAAGGATGCCCAGGCGACTTATTTTGCCACAACGACTGC
TGTCATCCAACTTTCGTCGTCTGGCTCTGTTTCTTATCTTCCAATCGATGCGACCAACGAGGGTGCCAATTCTAA
TTCCAACTGGGCGACTGTCAGTAATTTGCCGGTGGCGACTCCAGCCAAGCCGTCTTCTGCTTCTGGTTCTGCTTC
GGGCACCGGAAGTGCCGGAGCTCAAAGTACTGGCTCGACTTCAGATGGTACGATGGACAATGGTGCTGCAGTTCT
GAATGTTGGACGTTGGGTGTGGAGTGCCGTTGCACTCATGGTCGGAGCAGCGCTCTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail