Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|016860
Gene name
Locationscaffold_10:539136..539887
Strand+
Gene length (bp)751
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 1.7E-05 27 120

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999759

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3401
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016860 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|016860
Rhodonia placenta FPRL280 RhoplFPRL280|148_12

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|016860
MVALSALALALSAASLAAAQSTFQITNPSADHWWVAESSNVLTWDCKNNPHTTFGVFIANADQTLFAGDLAIIPQ
QPNADCSKEITHNQVNQPPGSGYIIKFANAVNSSEVFAQSDQFEIRPLGSAFPTTSSPAGNSPSNTADNTAAGAS
STDTPNGAASLKTLGVGFTAAAAGALAYLM*
Coding >AgabiH39|016860
ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC
ACCAATCCCTCCGCGGACCACTGGTGGGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCA
CATACCACCTTTGGTGTTTTCATTGCCAACGCAGACCAAACATTGTTTGCAGGAGACCTCGCTATTATCCCTCAA
CAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGGCTACATAATC
AAGTTCGCCAACGCTGTCAACAGCTCAGAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCT
GCGTTCCCCACTACCTCGTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCA
TCCACTGACACACCCAACGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCC
TTGGCGTATCTCATGTGA
Transcript >AgabiH39|016860
ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC
ACCAATCCCTCCGCGGACCACTGGTGGGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCA
CATACCACCTTTGGTGTTTTCATTGCCAACGCAGACCAAACATTGTTTGCAGGAGACCTCGCTATTATCCCTCAA
CAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGGCTACATAATC
AAGTTCGCCAACGCTGTCAACAGCTCAGAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCT
GCGTTCCCCACTACCTCGTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCA
TCCACTGACACACCCAACGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCC
TTGGCGTATCTCATGTGA
Gene >AgabiH39|016860
ATGGTCGCCCTCTCCGCCCTCGCCCTTGCTCTCTCTGCCGCCAGCCTTGCCGCTGCCCAGTCCACCTTCCAGATC
ACCAATCCCTCCGCGGACCACTGGTGGGGTGAGCTGTCGTCTTTTCTTCCTAGCTACAAACACAACTGACAGAAA
CTAGTTGCTGAATCGTCGAATGTTCTTACTTGGGACTGCAAGAACAACCCACATACCACCTTTGGTGTTTTGTAC
GTGTCTGGCTCCCCACTTCACTGGCCTGTTCTCACGCCTCTCTCTCGTCTAGCATTGCCAACGCAGTATGGCTAC
TCGTTAGCATAAAATAAAATAATTATACTCATCCATTTCACAGGACCAAACATTGTTTGCAGGAGACCTCGCTAT
TATCCCTCAACAGCCTAATGCCGATTGCTCCAAGGAAATCACTCACAACCAAGTCAACCAACCTCCCGGCAGTGG
CTACATAATCAAGTTCGCCAACGCTGTCAACAGCTCAGAGGTACGTTTTTCCCGCTCTTCGCTCCAACCCGTGCT
GATCCTTTCAAAGGTCTTTGCTCAATCTGACCAGTTCGAGATCAGACCTCTCGGTTCTGCGTTCCCCACTACCTC
GTCACCAGCAGGTAATAGCCCATCCAATACCGCAGACAACACAGCCGCCGGTGCTTCATCCACTGACACACCCAA
CGGCGCCGCCTCTCTCAAAACTCTCGGTGTCGGTTTCACCGCTGCCGCAGCTGGTGCCTTGGCGTATCTCATGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail