Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|016000
Gene name
Locationscaffold_10:317282..320435
Strand-
Gene length (bp)3153
Transcript length (bp)2751
Coding sequence length (bp)2751
Protein length (aa) 917

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-06 767 801
PF13374 TPR_10 Tetratricopeptide repeat 2.0E-03 802 825
PF13374 TPR_10 Tetratricopeptide repeat 1.9E-04 834 864
PF13374 TPR_10 Tetratricopeptide repeat 6.5E-09 866 904
PF13424 TPR_12 Tetratricopeptide repeat 1.0E-12 762 825
PF01734 Patatin Patatin-like phospholipase 5.1E-22 14 219
PF07721 TPR_4 Tetratricopeptide repeat 4.4E-01 761 783
PF00931 NB-ARC NB-ARC domain 1.4E-06 394 609

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 6 330 6.0E-20
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 11 311 4.0E-19
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 6 330 2.0E-18
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 6 336 2.0E-18
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 11 329 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 6 330 6.0E-20
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 11 311 4.0E-19
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 6 330 2.0E-18
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 6 336 2.0E-18
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 11 329 2.0E-12
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 762 889 3.0E-12
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 762 904 7.0E-11
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 762 907 7.0E-11
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 675 887 1.0E-10
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 611 904 2.0E-10
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 759 907 2.0E-10
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 763 904 3.0E-10
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 762 887 3.0E-10
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 764 899 4.0E-10
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 762 904 5.0E-10
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 762 904 6.0E-10
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 762 889 8.0E-10
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 11 298 1.0E-09
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 11 298 1.0E-09
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 764 905 6.0E-09
sp|O23179|PLP1_ARATH Patatin-like protein 1 OS=Arabidopsis thaliana GN=PLP1 PE=1 SV=2 8 315 8.0E-09
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 764 898 1.0E-08
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 4 222 1.0E-08
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 762 904 2.0E-08
sp|Q84QY3|PLP1_ORYSJ Patatin-like protein 1 OS=Oryza sativa subsp. japonica GN=PLP1 PE=3 SV=1 4 222 3.0E-08
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 763 904 3.0E-08
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 685 907 5.0E-08
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 764 899 8.0E-08
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 675 905 1.0E-07
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 763 905 3.0E-07
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 763 905 3.0E-07
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 763 905 3.0E-07
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 685 907 4.0E-07
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 753 905 5.0E-07
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 764 883 5.0E-07
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 12 220 5.0E-07
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 764 883 6.0E-07
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 764 883 8.0E-07
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 675 887 2.0E-06
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 762 889 3.0E-06
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 752 909 3.0E-06
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 685 889 3.0E-06
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 762 889 3.0E-06
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 685 896 3.0E-06
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 685 896 3.0E-06
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 763 905 3.0E-06
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 763 905 5.0E-06
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 763 905 5.0E-06
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 763 905 5.0E-06
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 763 905 6.0E-06
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 728 889 8.0E-06
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 685 899 8.0E-06
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 764 890 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042802 identical protein binding Yes
GO:0006629 lipid metabolic process Yes
GO:0043531 ADP binding Yes
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0044238 primary metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|016000
MTSSSAEGPPLRLLALDGGGIRGLSELLILKEVMHKLMFEENEKRKKDGEEPLNVLPKPCDYFDLIGGTSTGGII
ALMLGRLRMDVDAAIKSYDDLAKQVFSAMKPWGHWGDGKFKATALEAAMKSVVKTVTGDSESPLLEGDQAGVCRT
FVCTKNAYNMDIPVLFRTYQSNETHSNCKIWEAARATSAAPTFFKRVIIGRDQPFIDGGLGRNNPSQVVLEEASA
LFGARRIGCLVSIGTGQAGVNEIKKPGLWQQILPTDVIDALRRITTDCESIHEDVLRRFSKLPYSYFRLNVEQGL
QGIELSEWEKLSNVEAHTMQYMKKAEVAQKLALLVSAIRVPRGQLPLEQFMTPGPPNESVPQARERKRCPLPVQP
FMGREEILDKMRKYFELGGDSRRVFVLHGLGGSGKTQIALKFVQESTCFSNVFYIDATNEQTLRTDLEAIALGNT
ERSVDASLHWLASQREGNWLLFFDNADDVNLKLKNFIPQCQSGNILVTTRNQELRLLSAKDGDAKIGAMEHEDAR
NLLLYRARAEESDENNVLAEAIVQELHYFALAISQAGAYIHCQLSLSEYREFYRRHHDKLLQHEELQGEDPYERA
VYATWSLSYNKLEMSARSLLQIFSVLHHEGISEKMFEKAASSKEQLEDSELQNKVTELLNELGKRGPDWPWDFKQ
VTKRLCSHSLIEYDGRNRTYSIHPLVQQWSRSTMAGNRQLMQKCVLSIIHLSISWTFNDEDYKHRRTLLQHISSS
RASIDPEEMTPSVLYGMALVYFEQGQWKEAEALYVVVMEKRKGLLGDDHPETLTSMASLATTYWKQGQWKDAEAL
EVVVMEKSMYRDQGQWKAAEALEVVVMEKRKGLLGDDHPYTLTSMANLAATYRNQGQWKEAEALEVVVMEKSKRL
LGDDYDHLSSYPTYER*
Coding >AgabiH39|016000
ATGACTTCTTCTTCTGCAGAAGGACCACCTTTGAGGTTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTTTCA
GAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAGGACGGCGAA
GAACCTCTTAATGTACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGGATAATT
GCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACGCAGCAATCAAAAGCTACGATGATCTGGCAAAACAAGTC
TTCTCCGCTATGAAGCCATGGGGACATTGGGGAGATGGAAAATTCAAAGCGACAGCACTCGAAGCAGCCATGAAA
TCTGTCGTGAAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGGTGATCAAGCTGGAGTCTGCCGAACT
TTCGTCTGCACAAAGAACGCCTACAACATGGACATTCCAGTGCTTTTCAGGACATACCAGTCTAATGAAACACAT
TCAAATTGCAAGATCTGGGAGGCCGCTCGAGCGACATCTGCAGCACCTACGTTTTTTAAGCGCGTTATAATTGGG
CGGGACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTACTGGAAGAAGCCAGTGCT
CTATTTGGCGCTCGTCGAATCGGGTGCTTGGTGAGCATTGGCACTGGACAGGCCGGAGTAAACGAGATCAAGAAA
CCTGGGTTATGGCAGCAAATCCTACCAACCGACGTCATCGACGCGTTAAGGAGAATTACCACCGACTGCGAATCA
ATACACGAAGATGTGTTGCGCCGTTTCTCCAAGTTGCCGTACAGCTATTTTCGACTAAATGTCGAGCAGGGGTTG
CAGGGAATAGAGCTTTCCGAATGGGAGAAACTGAGTAATGTGGAGGCTCATACAATGCAATATATGAAGAAGGCG
GAGGTCGCTCAGAAGCTTGCCTTGTTGGTTAGTGCGATCAGAGTCCCGAGAGGGCAGCTTCCACTCGAGCAATTC
ATGACTCCTGGGCCTCCAAATGAATCGGTCCCACAAGCCAGGGAACGTAAGCGTTGTCCACTTCCTGTGCAGCCA
TTCATGGGACGAGAGGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTGGGGGGTGATTCTCGACGCGTCTTC
GTTTTGCATGGCCTTGGGGGATCCGGCAAGACCCAAATTGCTTTGAAATTTGTGCAAGAATCAACCTGCTTCTCC
AACGTCTTCTACATTGACGCAACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCGCTCTAGGAAATACA
GAGCGGTCAGTAGATGCGAGTCTCCATTGGCTTGCAAGTCAGCGCGAGGGGAACTGGCTTCTCTTCTTCGACAAC
GCGGACGATGTGAACTTGAAACTGAAGAATTTCATTCCTCAGTGTCAATCTGGAAACATCCTGGTTACAACACGT
AATCAAGAGCTTCGCCTTCTCTCTGCGAAAGACGGAGATGCAAAAATTGGTGCAATGGAGCACGAAGACGCAAGA
AACCTGCTGCTGTATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAATGTGCTGGCAGAGGCAATTGTACAGGAA
CTCCATTACTTTGCTTTGGCTATTTCTCAAGCTGGCGCTTACATTCATTGCCAGTTGTCATTAAGCGAATATCGA
GAATTCTATCGACGTCACCATGACAAACTGCTACAGCATGAAGAGCTTCAAGGAGAAGATCCATACGAACGAGCG
GTGTATGCGACGTGGAGTTTGAGCTACAACAAACTTGAGATGTCAGCAAGATCTTTGCTCCAAATTTTCTCGGTG
CTACACCACGAAGGAATTTCAGAGAAAATGTTCGAAAAGGCGGCATCGTCTAAAGAGCAACTGGAGGATTCTGAA
CTACAAAACAAAGTGACGGAGTTGCTGAACGAGCTGGGAAAACGAGGTCCTGACTGGCCTTGGGACTTTAAGCAG
GTCACCAAGCGCCTTTGTTCACATTCGCTCATTGAATATGATGGTCGAAATCGAACCTACAGCATTCATCCACTA
GTACAACAGTGGAGTCGCAGCACCATGGCAGGAAACAGACAGCTCATGCAGAAATGTGTACTCAGCATCATTCAC
CTATCGATTTCTTGGACATTCAACGACGAGGACTACAAGCATCGGCGCACACTTTTGCAGCATATCTCCAGTTCC
AGAGCCTCGATCGATCCAGAAGAGATGACGCCTTCCGTTTTGTATGGTATGGCACTTGTGTACTTTGAACAGGGG
CAGTGGAAGGAAGCAGAGGCGCTTTATGTGGTGGTAATGGAGAAGAGGAAGGGGCTGCTTGGTGATGATCATCCT
GAGACACTCACAAGCATGGCCAGTCTTGCGACCACGTACTGGAAGCAGGGGCAGTGGAAGGACGCGGAGGCGCTT
GAGGTGGTGGTGATGGAGAAGAGCATGTACAGGGACCAGGGGCAGTGGAAGGCAGCAGAGGCGCTTGAGGTTGTG
GTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTCACGAGCATGGCCAATCTTGCAGCC
ACGTACAGGAATCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTTGTGGTGATGGAGAAGAGTAAGCGGCTG
CTCGGTGATGATTATGATCATTTGTCTTCATATCCTACATACGAAAGATGA
Transcript >AgabiH39|016000
ATGACTTCTTCTTCTGCAGAAGGACCACCTTTGAGGTTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTTTCA
GAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAGGACGGCGAA
GAACCTCTTAATGTACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGGATAATT
GCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACGCAGCAATCAAAAGCTACGATGATCTGGCAAAACAAGTC
TTCTCCGCTATGAAGCCATGGGGACATTGGGGAGATGGAAAATTCAAAGCGACAGCACTCGAAGCAGCCATGAAA
TCTGTCGTGAAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGGTGATCAAGCTGGAGTCTGCCGAACT
TTCGTCTGCACAAAGAACGCCTACAACATGGACATTCCAGTGCTTTTCAGGACATACCAGTCTAATGAAACACAT
TCAAATTGCAAGATCTGGGAGGCCGCTCGAGCGACATCTGCAGCACCTACGTTTTTTAAGCGCGTTATAATTGGG
CGGGACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTACTGGAAGAAGCCAGTGCT
CTATTTGGCGCTCGTCGAATCGGGTGCTTGGTGAGCATTGGCACTGGACAGGCCGGAGTAAACGAGATCAAGAAA
CCTGGGTTATGGCAGCAAATCCTACCAACCGACGTCATCGACGCGTTAAGGAGAATTACCACCGACTGCGAATCA
ATACACGAAGATGTGTTGCGCCGTTTCTCCAAGTTGCCGTACAGCTATTTTCGACTAAATGTCGAGCAGGGGTTG
CAGGGAATAGAGCTTTCCGAATGGGAGAAACTGAGTAATGTGGAGGCTCATACAATGCAATATATGAAGAAGGCG
GAGGTCGCTCAGAAGCTTGCCTTGTTGGTTAGTGCGATCAGAGTCCCGAGAGGGCAGCTTCCACTCGAGCAATTC
ATGACTCCTGGGCCTCCAAATGAATCGGTCCCACAAGCCAGGGAACGTAAGCGTTGTCCACTTCCTGTGCAGCCA
TTCATGGGACGAGAGGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTGGGGGGTGATTCTCGACGCGTCTTC
GTTTTGCATGGCCTTGGGGGATCCGGCAAGACCCAAATTGCTTTGAAATTTGTGCAAGAATCAACCTGCTTCTCC
AACGTCTTCTACATTGACGCAACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCGCTCTAGGAAATACA
GAGCGGTCAGTAGATGCGAGTCTCCATTGGCTTGCAAGTCAGCGCGAGGGGAACTGGCTTCTCTTCTTCGACAAC
GCGGACGATGTGAACTTGAAACTGAAGAATTTCATTCCTCAGTGTCAATCTGGAAACATCCTGGTTACAACACGT
AATCAAGAGCTTCGCCTTCTCTCTGCGAAAGACGGAGATGCAAAAATTGGTGCAATGGAGCACGAAGACGCAAGA
AACCTGCTGCTGTATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAATGTGCTGGCAGAGGCAATTGTACAGGAA
CTCCATTACTTTGCTTTGGCTATTTCTCAAGCTGGCGCTTACATTCATTGCCAGTTGTCATTAAGCGAATATCGA
GAATTCTATCGACGTCACCATGACAAACTGCTACAGCATGAAGAGCTTCAAGGAGAAGATCCATACGAACGAGCG
GTGTATGCGACGTGGAGTTTGAGCTACAACAAACTTGAGATGTCAGCAAGATCTTTGCTCCAAATTTTCTCGGTG
CTACACCACGAAGGAATTTCAGAGAAAATGTTCGAAAAGGCGGCATCGTCTAAAGAGCAACTGGAGGATTCTGAA
CTACAAAACAAAGTGACGGAGTTGCTGAACGAGCTGGGAAAACGAGGTCCTGACTGGCCTTGGGACTTTAAGCAG
GTCACCAAGCGCCTTTGTTCACATTCGCTCATTGAATATGATGGTCGAAATCGAACCTACAGCATTCATCCACTA
GTACAACAGTGGAGTCGCAGCACCATGGCAGGAAACAGACAGCTCATGCAGAAATGTGTACTCAGCATCATTCAC
CTATCGATTTCTTGGACATTCAACGACGAGGACTACAAGCATCGGCGCACACTTTTGCAGCATATCTCCAGTTCC
AGAGCCTCGATCGATCCAGAAGAGATGACGCCTTCCGTTTTGTATGGTATGGCACTTGTGTACTTTGAACAGGGG
CAGTGGAAGGAAGCAGAGGCGCTTTATGTGGTGGTAATGGAGAAGAGGAAGGGGCTGCTTGGTGATGATCATCCT
GAGACACTCACAAGCATGGCCAGTCTTGCGACCACGTACTGGAAGCAGGGGCAGTGGAAGGACGCGGAGGCGCTT
GAGGTGGTGGTGATGGAGAAGAGCATGTACAGGGACCAGGGGCAGTGGAAGGCAGCAGAGGCGCTTGAGGTTGTG
GTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTCACGAGCATGGCCAATCTTGCAGCC
ACGTACAGGAATCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTTGTGGTGATGGAGAAGAGTAAGCGGCTG
CTCGGTGATGATTATGATCATTTGTCTTCATATCCTACATACGAAAGATGA
Gene >AgabiH39|016000
ATGACTTCTTCTTCTGCAGAAGGACCACCTTTGAGGTTGCTTGCGCTAGGTATACGCGCCCCTTACACTCTCTTA
CCGATGGAGTCGCTAACTAGTAAACTCTGAACAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCCTC
AAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAGGACGGCGAAGAACCTCTTAATGTA
CTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGGTGCGTTGCGCTATGCATCTGC
AACCGTCACATGTTACTCACTTGTATATTACAGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGA
CGCAGCAATCAAAAGCTACGATGATCTGGCAAAACAAGTCTTCTCCGCTATGAAGCCATGGGGACATTGGGGAGA
TGGAAAATTCAAAGCGACAGCACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTGGTGATTCCGAGTC
ACCCTTATTAGAAGGTGATCAAGCTGGAGTCTGCCGAACGTGAGCGTATTACTTACTCTTCCATGCATTTGAACT
TTGAATTCGAAGATTTATTAGTTTCGTCTGCACAAAGAACGCCTACAACATGGACATTCCAGTGCTTTTCAGGAC
ATACCAGTCTAATGAAACACATTCAAATTGCAAGATCTGGGAGGCCGCTCGAGCGACATCTGCAGCACCTACGTT
TTTTAAGCGCGTTATAATTGGGCGGGACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGT
GGTACTGGAAGAAGCCAGTGCTCTATTTGGCGCTCGTCGAATCGGGTGCTTGGTGAGCATTGGCACTGGACAGGC
CGGAGTAAACGAGATCAAGAAACCTGGGTTATGGCAGCAAATCCTACCAACCGACGTCATCGACGCGTTAAGGAG
AATTACCACCGACTGCGAATCAATACACGAAGATGTGTTGCGCCGTTTCTCCAAGTTGCCGTACAGCTATTTTCG
ACTAAATGTCGAGCAGGGGTTGCAGGGAATAGAGCTTTCCGAATGGGAGAAACTGAGTAATGTGGAGGCTCATAC
AATGCAATATATGAAGAAGGCGGAGGTCGCTCAGAAGCTTGCCTTGTTGGTTAGTGCGATCAGAGTCCCGAGAGG
GCAGCTTCCACTCGAGCAATTCAGTATGGAGAAATCGTTCTTGTAGAACTTCATAACAATCTAATCTCGTTTCCC
TAGTGACTCCTGGGCCTCCAAATGAATCGGTCCCACAAGCCAGGGAACGTAAGCGTTGTCCACTTCCTGTGCAGC
CATTCATGGGACGAGAGGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTGGGGGGTGATTCTCGACGCGTCT
TCGTTTTGCATGGCCTTGGGGGATCCGGCAAGACCCAAATTGCTTTGAAATTTGTGCAAGAATCAACCTGGTATG
ATACTACTCTCTACAAATTCGCGACTGGCGACAATTTATATGTTTAATTTCCAGCTTCTCCAACGTCTTCTACAT
TGACGCAACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCGCTCTAGGAAATACAGAGCGGTCAGTAGA
TGCGAGTCTCCATTGGCTTGCAAGTCAGCGCGAGGGGAACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAA
CTTGAAACTGAAGAATTTCATTCCTCAGTGTCAATCTGGAAACATCCTGGTTACAACACGTAATCAAGAGCTTCG
CCTTCTCTCTGCGAAAGACGGAGATGCAAAAATTGGTGCAATGGAGCACGAAGACGCAAGAAACCTGCTGCTGTA
TCGGGCTCGGGCAGAAGAGAGCGATGAAAATAATGTGCTGGCAGAGGCAATTGTACAGGTTCTTCCTTTCATTTT
TGTTTCTTAGAAACGCTCTCAGTCTAAAGCACGAAACAGGAACTCCATTACTTTGCTTTGGCTATTTCTCAAGCT
GGCGCTTACATTCATTGCCAGTTGTCATTAAGCGAATATCGAGAATTCTATCGACGTCACCATGACAAACTGCTA
CAGCATGAAGAGCTTCAAGGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACAACAAA
CTTGAGATGTCAGCAAGATCTTTGCTCCAAATTTTCTCGGTGCTACACCACGAAGGAATTTCAGAGAAAATGTTC
GAAAAGGCGGCATCGTCTAAAGAGCAACTGGAGGATTCTGAACTACAAAACAAAGTGACGGAGTTGCTGAACGAG
CTGGGAAAACGAGGTCCTGACTGGCCTTGGGACTTTAAGCAGGTCACCAAGCGCCTTTGTTCACATTCGCTCATT
GAATATGATGGTCGAAATCGAACCTACAGCATTCATCCACTAGTACAACAGTGGAGTCGCAGCACCATGGCAGGA
AACAGACAGCTCATGCAGAAATGTGTACTCAGCATCATTCACCTATCGATTTCTTGGACATTCAACGACGAGGAC
TACAAGCATCGGCGCACACTTTTGCAGCATATCTCCAGTTCCAGAGCCTCGATCGATCCAGAAGAGATGACGCCT
TCCGTTTTGTATGGTATGGCACTTGTGTACTTTGAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTTATGTGGTG
GTAATGGAGAAGAGGAAGGGGCTGCTTGGTGATGATCATCCTGAGACACTCACAAGCATGGCCAGTCTTGCGACC
ACGTACTGGAAGCAGGGGCAGTGGAAGGACGCGGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGTAAGTGGCTG
CTCGGTGATGATCATCCTGACACGCTCAGGAGCATGGGCAATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGG
AAGGCAGCAGAGGCGCTTGAGGTTGTGGTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACA
CTCACGAGCATGGCCAATCTTGCAGCCACGTACAGGAATCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTT
GTGGTGATGGAGAAGAGTAAGCGGCTGCTCGGTGATGATTATGATCATTTGTCTTCATATCCTACATACGAAAGA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail