Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|012150
Gene name
Locationscaffold_01:2937958..2939988
Strand+
Gene length (bp)2030
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05978 UNC-93 Ion channel regulatory protein UNC-93 1.5E-14 72 407
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-11 74 409

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 3 459 6.0E-136
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 33 431 2.0E-108
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 33 431 2.0E-108
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 44 462 2.0E-58

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 67 89 22
3 94 116 22
4 123 145 22
5 160 182 22
6 195 214 19
7 252 269 17
8 289 306 17
9 316 338 22
10 363 385 22
11 421 443 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup527
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|012150 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|012160
Agaricus bisporus var bisporus H39 AgabiH39|087950
Agaricus bisporus var bisporus H97 AgabiH97|012150
Agaricus bisporus var bisporus H97 AgabiH97|012160
Agaricus bisporus var bisporus H97 AgabiH97|087950
Rhodonia placenta FPRL280 RhoplFPRL280|42_18

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|012150
MAEVEKSSNFETSEGGSVQIFERPKGLKGLYLNPLTQVILLGFVCFMCPGLFNALNGLGGGGQIDTAVSANANSA
LYSTFAVGAFFAGSVNNMLGPRWTLLLGSAGYPLYIGSFLAINIHPKAGGFVIGAGAILGLCAGLLWTAQGSLML
SYPTESQKGLFISVFWAIFNLGAVVGASVSLGQNYQSQANSVGNETYIGFLILTLIGVAIPFVMADPSKIIRLDG
TRVTTPRNPSWKTEFLGLWITFREDPYVLLLFPMFLASNWFYTWQFNEYNNALFNIRARSLNNLMYWLAQIIGSL
SIGFILDQRNLSRRFRAFTGWIILLVMVFVVHTWAYFYQKNYTRDSVTHKLDIFDHGYAGRAILYIFYGFLDSMW
QTAVYWLLGAMSNNPSKLAYFTGFYKSIQSAGAAGTWSADAKKTPYMTMFISTWVLLASGLVFALPLIHMRVTNH
TYSSDDFPPQSSDHEDRES*
Coding >AgabiH39|012150
ATGGCAGAAGTTGAGAAATCATCTAATTTCGAAACCAGCGAAGGAGGTTCCGTCCAGATCTTCGAGAGACCAAAG
GGTCTCAAGGGGTTGTACCTTAACCCATTGACCCAGGTCATTTTGTTGGGGTTTGTTTGCTTCATGTGTCCTGGG
CTCTTCAATGCCTTGAATGGCCTTGGGGGAGGGGGACAGATCGACACGGCAGTCAGCGCCAATGCGAATTCGGCT
TTGTACTCCACTTTTGCAGTGGGTGCTTTTTTTGCCGGGTCTGTCAACAATATGTTAGGGCCGCGGTGGACTCTT
CTACTGGGTAGTGCGGGGTACCCTTTGTACATTGGATCTTTTTTGGCTATCAACATCCACCCTAAAGCAGGCGGC
TTCGTTATCGGAGCTGGGGCCATCCTTGGACTATGCGCTGGTTTGTTATGGACCGCTCAAGGTTCACTCATGCTA
TCCTATCCCACGGAAAGCCAAAAGGGTTTATTTATCAGTGTATTTTGGGCTATCTTCAATCTCGGCGCGGTCGTC
GGGGCTAGTGTTTCTCTGGGGCAAAACTATCAATCTCAAGCTAATTCAGTTGGCAACGAGACTTATATTGGTTTC
CTTATTCTGACGCTGATCGGAGTCGCTATCCCCTTCGTAATGGCTGATCCTTCAAAGATTATCCGTTTAGACGGT
ACACGAGTGACGACTCCTCGTAACCCATCATGGAAGACTGAATTTCTGGGACTCTGGATCACCTTCAGGGAAGAT
CCATATGTTCTTCTACTATTCCCCATGTTCCTTGCATCGAACTGGTTCTACACGTGGCAGTTTAATGAATACAAC
AATGCCCTGTTCAACATCCGCGCGCGTTCTCTAAATAACCTTATGTACTGGCTGGCCCAGATTATTGGCTCGCTC
TCTATAGGATTCATCCTCGATCAAAGAAATCTGTCTCGACGTTTTCGTGCATTCACTGGTTGGATCATTCTTCTG
GTGATGGTGTTCGTGGTCCACACTTGGGCATATTTCTATCAAAAGAATTATACCAGAGACTCTGTTACCCACAAA
CTAGATATCTTTGACCATGGATATGCAGGACGGGCTATCCTGTATATCTTCTATGGTTTCCTCGATTCTATGTGG
CAAACGGCCGTCTATTGGCTATTGGGAGCTATGTCCAATAATCCGAGTAAATTGGCATACTTCACAGGTTTCTAT
AAGTCAATTCAGTCAGCCGGCGCTGCGGGTACCTGGAGTGCTGACGCCAAAAAGACACCGTACATGACCATGTTC
ATTTCTACATGGGTTCTCCTCGCATCGGGCCTGGTCTTTGCGCTTCCTCTTATCCATATGCGCGTTACGAATCAT
ACATACTCCTCCGATGATTTTCCACCTCAGTCTAGCGATCACGAAGATCGTGAAAGCTGA
Transcript >AgabiH39|012150
ATGGCAGAAGTTGAGAAATCATCTAATTTCGAAACCAGCGAAGGAGGTTCCGTCCAGATCTTCGAGAGACCAAAG
GGTCTCAAGGGGTTGTACCTTAACCCATTGACCCAGGTCATTTTGTTGGGGTTTGTTTGCTTCATGTGTCCTGGG
CTCTTCAATGCCTTGAATGGCCTTGGGGGAGGGGGACAGATCGACACGGCAGTCAGCGCCAATGCGAATTCGGCT
TTGTACTCCACTTTTGCAGTGGGTGCTTTTTTTGCCGGGTCTGTCAACAATATGTTAGGGCCGCGGTGGACTCTT
CTACTGGGTAGTGCGGGGTACCCTTTGTACATTGGATCTTTTTTGGCTATCAACATCCACCCTAAAGCAGGCGGC
TTCGTTATCGGAGCTGGGGCCATCCTTGGACTATGCGCTGGTTTGTTATGGACCGCTCAAGGTTCACTCATGCTA
TCCTATCCCACGGAAAGCCAAAAGGGTTTATTTATCAGTGTATTTTGGGCTATCTTCAATCTCGGCGCGGTCGTC
GGGGCTAGTGTTTCTCTGGGGCAAAACTATCAATCTCAAGCTAATTCAGTTGGCAACGAGACTTATATTGGTTTC
CTTATTCTGACGCTGATCGGAGTCGCTATCCCCTTCGTAATGGCTGATCCTTCAAAGATTATCCGTTTAGACGGT
ACACGAGTGACGACTCCTCGTAACCCATCATGGAAGACTGAATTTCTGGGACTCTGGATCACCTTCAGGGAAGAT
CCATATGTTCTTCTACTATTCCCCATGTTCCTTGCATCGAACTGGTTCTACACGTGGCAGTTTAATGAATACAAC
AATGCCCTGTTCAACATCCGCGCGCGTTCTCTAAATAACCTTATGTACTGGCTGGCCCAGATTATTGGCTCGCTC
TCTATAGGATTCATCCTCGATCAAAGAAATCTGTCTCGACGTTTTCGTGCATTCACTGGTTGGATCATTCTTCTG
GTGATGGTGTTCGTGGTCCACACTTGGGCATATTTCTATCAAAAGAATTATACCAGAGACTCTGTTACCCACAAA
CTAGATATCTTTGACCATGGATATGCAGGACGGGCTATCCTGTATATCTTCTATGGTTTCCTCGATTCTATGTGG
CAAACGGCCGTCTATTGGCTATTGGGAGCTATGTCCAATAATCCGAGTAAATTGGCATACTTCACAGGTTTCTAT
AAGTCAATTCAGTCAGCCGGCGCTGCGGGTACCTGGAGTGCTGACGCCAAAAAGACACCGTACATGACCATGTTC
ATTTCTACATGGGTTCTCCTCGCATCGGGCCTGGTCTTTGCGCTTCCTCTTATCCATATGCGCGTTACGAATCAT
ACATACTCCTCCGATGATTTTCCACCTCAGTCTAGCGATCACGAAGATCGTGAAAGCTGA
Gene >AgabiH39|012150
ATGGCAGAAGTTGAGAAATCATCTAATTTCGAAACCAGCGAAGGAGGTTCCGTCCAGATCTTCGAGAGACCAAAG
GGTCTCAAGGGGTTGTACCTTAACCCATTGACCCAGGTCATTTTGTTGGGGTTTGTTTGCTTCATGTGTCCTGGT
GGGTGTTGTGTTTTCTTTCCCCCCTTTTTTTTGCGATACTAAACCCGCGCAAGGGCTCTTCAATGCCTTGAATGG
CCTTGGGGGAGGGGGACAGATCGACACGGCAGTCAGCGCCAATGCGAATTCGGCTTTGTACTCCACTTTTGCAGT
GGGTGCTTTTTTTGCCGGGTAAAGCCATCATCTTCATCAGTGATGTCGGCTCATGTTCTCAATCTCCAAAAGGTC
TGTCAACAATATGTTAGGGCCGCGGTGGACTCTTCTACTGGGTAGTGCGGGGTACCCTTTGTACATTGGATCTTT
TTTGTGAGTTCTGACTAATCGAGAATCTGTATACCTACGAAATACTCAGACTATTATTAGGGCTATCAACATCCA
CCCTAAAGCAGGCGGCTTCGTTATCGGAGCTGGGGCCATCCTTGGACTATGCGCTGGTTTGTTATGGACCGCTCA
AGGTTCACTCATGCTATCCTATCCCACGGAAAGCCAAAAGGGTTTATTTATCAGTGTATTTTGGGCTATCTTCAA
TCTCGGCGCGGTCGTCGGGGCTAGTGTTTCTCTGGGGCAAAACTATCAATCTCAAGTACGTGATGCGGGCTTGCG
TGTTTGGATGCTGATACTGATAATGTTCATCACGATAGGCTAATTCAGGTCAGTATTGGAATTCGTGGTGTCACG
CTCGAGCTGAACGAACCGTATCAATGAATTGCAGTTGGCAACGAGACTTATGTGAGCCAGCACGCGTTAGTTTGG
ACGAATTCGAGAGTTCATGATGTACAACTTTAGATTGGTTTCCTTATTCTGACGCTGATCGGAGTCGCTATCCCC
TTCGTAATGGCTGATCCTTCAAAGATTATCCGTTTAGACGGTACACGAGTGACGACTCCTCGTAACCCATCATGG
AAGACTGAATTTCTGGGACTCTGGATCACCTTCAGGGAAGATCCATATGTTCTTCTACTATTCCCCATGTTCCTT
GCATCGAACTGGTTCTACACGTGGCGTAAGTCTAATTAACCTTACTATCATCTATCACGCTATTTACCGGTCTAT
ACAGAGTTTAATGAATACAACAATGCCCTGTTCAACATCCGCGCGCGTTCTCTAAATAACCTTATGTACTGGCTG
GCCCAGATTATTGGCTCGCTCTCTATAGGATTCATCCTCGATCAAAGAAATCTGTCTCGACGTTTTCGTGCATTC
ACTGGTTGGATCATTCTTCTGGTGATGGTGTTCGTGGTCCACACTTGGGCATATTTCTATCAAAAGTACGGTGCT
TTTACCTTCTTATAGGATAATCGACTGACAAAATGACGCGATCAGGAATTATACCAGAGACTCTGTTACCCACAA
ACTAGATATCTTTGACCATGGATATGCAGGACGGGCTATCCTGTATATCTTCTATGGTTTCCTCGATTCTATGTG
GCAAACGGCCGTCTATTGGCTATTGGGAGCTATGTCCAATAATCCGAGTAAATTGGCATACTTCACAGGTTTCTG
TAAGTGCTTCCTATCGCAGCTGTTTTCCTTTTAAGCATGTCAGCCAACAGATAAGTCAATTCAGTCAGCCGGCGC
TGCGGGTACCTGGAGTGCTGACGCCAAAAAGACACCGTACGCCCTCGTTCTTTGATAAGATTGACGTGGCTTTCT
GAGATACTTATCTAGGTACATGACCATGTTCATTTCTACATGGGTTCTCCTCGCATCGGGCCTGGTCTTTGCGCT
TCCTCTTATCCATATGCGCGTTACGAATCATACATACTCCTCCGATGATTTTCCGTGCGTATTTTTCTGTACCTC
TTGCGCGACCTATTAATTTTGAGTATTGAATCTTTAATTGTAGACCTCAGTCTAGCGATCACGAAGATCGTGAAA
GCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail