Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|011100
Gene name
Locationscaffold_01:2670278..2672210
Strand+
Gene length (bp)1932
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 6.0E-21 30 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 5 341 9.0E-86
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 5 322 5.0E-85
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 29 322 6.0E-78
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 5 326 2.0E-72
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 28 328 5.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 5 341 9.0E-86
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 5 322 5.0E-85
sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 29 322 6.0E-78
sp|P29029|CHIT_YEAST Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS1 PE=1 SV=2 5 326 2.0E-72
sp|D4B4X4|CHI33_ARTBC Class III chitinase ARB_03514 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03514 PE=1 SV=2 28 328 5.0E-63
sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT3 PE=1 SV=2 9 315 7.0E-63
sp|Q12713|CHI33_TRIHA Endochitinase 33 OS=Trichoderma harzianum GN=chit33 PE=1 SV=1 28 326 1.0E-61
sp|P40953|CHI2_CANAL Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT2 PE=1 SV=1 28 315 2.0E-51
sp|Q5AAH2|CHI1_CANAL Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT1 PE=1 SV=1 29 330 4.0E-50
sp|P46876|CHI1_CANAX Chitinase 1 OS=Candida albicans GN=CHT1 PE=3 SV=2 29 330 8.0E-50
sp|P29060|CHIA_TOBAC Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=1 29 323 1.0E-47
sp|E9ENC6|CHI3_METRA Endochitinase 3 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi3 PE=3 SV=1 11 326 1.0E-47
sp|P51614|CHIT3_VITVI Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE=2 SV=1 30 307 7.0E-47
sp|P36910|CHIE_BETVU Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 PE=1 SV=1 10 326 2.0E-46
sp|P36908|CHIA_CICAR Acidic endochitinase OS=Cicer arietinum PE=2 SV=1 30 323 2.0E-46
sp|P19172|CHIA_ARATH Acidic endochitinase OS=Arabidopsis thaliana GN=CHIB1 PE=2 SV=2 1 307 3.0E-46
sp|Q6QDR4|CHI3_METAN Endochitinase 3 (Fragment) OS=Metarhizium anisopliae GN=chi3 PE=1 SV=1 30 317 2.0E-45
sp|P23472|CHLY_HEVBR Hevamine-A OS=Hevea brasiliensis PE=1 SV=2 30 322 4.0E-44
sp|P29024|CHIA_PHAAN Acidic endochitinase OS=Phaseolus angularis PE=2 SV=1 22 308 8.0E-44
sp|P29061|CHIB_TOBAC Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1 29 308 2.0E-43
sp|Q873Y0|CHIA1_ASPFM Endochitinase A1 OS=Neosartorya fumigata GN=chiA1 PE=1 SV=1 2 321 1.0E-40
sp|Q1EAR5|CHI2_COCIM Endochitinase 2 OS=Coccidioides immitis (strain RS) GN=CTS2 PE=3 SV=2 2 317 7.0E-40
sp|Q4WEP7|CHIA1_ASPFU Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiA1 PE=3 SV=1 2 321 7.0E-40
sp|P54197|CHI2_COCP7 Endochitinase 2 OS=Coccidioides posadasii (strain C735) GN=CTS2 PE=3 SV=2 4 317 7.0E-40
sp|E9F9R9|CHI2_METRA Endochitinase 2 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chi2 PE=3 SV=2 32 329 1.0E-39
sp|Q4U4T0|CHI2_METAN Endochitinase 2 OS=Metarhizium anisopliae GN=chi2 PE=1 SV=1 32 315 3.0E-39
sp|P17541|CHIA_CUCSA Acidic endochitinase OS=Cucumis sativus PE=1 SV=1 18 326 3.0E-37
sp|Q9C105|YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.04c PE=3 SV=1 3 312 5.0E-35
sp|D4AT07|CHI1_ARTBC Probable endochitinase ARB_07371 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07371 PE=3 SV=1 12 316 6.0E-35
sp|G5EB30|CHIA1_EMENI Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiA PE=1 SV=1 18 319 9.0E-34
sp|Q92223|CHIA1_EMEND Endochitinase A OS=Emericella nidulans GN=chiA PE=2 SV=3 18 319 9.0E-34
sp|A2QUQ2|CHIA1_ASPNC Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ctcA PE=2 SV=1 16 316 9.0E-31
sp|P49347|CONB_CANEN Concanavalin B OS=Canavalia ensiformis PE=1 SV=1 7 328 2.0E-23
sp|Q53NL5|XIP2_ORYSJ Xylanase inhibitor protein 2 OS=Oryza sativa subsp. japonica GN=Chib3H-h PE=1 SV=1 105 308 3.0E-18
sp|Q8L5C6|XIP1_WHEAT Xylanase inhibitor protein 1 OS=Triticum aestivum GN=XIPI PE=1 SV=2 29 308 2.0E-17
sp|Q7GCM7|XIP1_ORYSJ Xylanase inhibitor protein 1 OS=Oryza sativa subsp. japonica GN=RIXI PE=1 SV=1 103 308 3.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.99955

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH18 7.5E-22 29 277

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup304
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|011100 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|011110
Agaricus bisporus var bisporus H39 AgabiH39|035190
Agaricus bisporus var bisporus H39 AgabiH39|081510
Agaricus bisporus var bisporus H39 AgabiH39|081540
Agaricus bisporus var bisporus H97 AgabiH97|011100
Agaricus bisporus var bisporus H97 AgabiH97|011110
Agaricus bisporus var bisporus H97 AgabiH97|035190
Agaricus bisporus var bisporus H97 AgabiH97|081510
Agaricus bisporus var bisporus H97 AgabiH97|081540
Rhodonia placenta FPRL280 RhoplFPRL280|2_15
Rhodonia placenta FPRL280 RhoplFPRL280|28_25
Rhodonia placenta FPRL280 RhoplFPRL280|33_20

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|011100
MMLNIARTFIVLAFSTWLADAFDNSRFDNLAVYWGQNSYGAGHSDTANWQKPVSFYCNDDAINVFPVAFLHVFFG
PGGLPSINLANTCNDKDNSVFPGTDLPNCSALAADIKACQAKGKILTLSLGGATGSVGFQSDGQAETFAETIWNL
FLGGSSSTRPFGSASLDGIDLDIEGGSSAHYAAFVNKIRSLASGASKKYYVTAAPQCVYPDSALGGVLNSAHFDA
IYGKFYNNPCGLQNFNSVSNWNFGIWDNWARTISPNKDVKVYIGAPASSSAAGGGYVDSTTLRNIANKMRRSFPS
FGGVMLWDASQAYANNRYDQAIKNGLTSAGGTGFTFPPCSAPTYSAGEVYVGGLQASFGGYIWQSKWWTNSQPAH
NPFGDWSAISACR*
Coding >AgabiH39|011100
ATGATGCTGAACATTGCTCGGACTTTCATAGTTCTTGCTTTTTCGACTTGGTTGGCCGATGCCTTCGACAACAGT
CGTTTCGATAACTTGGCAGTATATTGGGGCCAGAATTCCTACGGGGCCGGTCATAGTGATACAGCAAACTGGCAG
AAGCCGGTATCCTTCTATTGCAATGATGATGCGATAAACGTCTTCCCTGTAGCTTTCCTACATGTCTTTTTTGGG
CCCGGCGGCCTTCCTTCCATCAACTTGGCCAATACCTGTAATGATAAAGACAACAGTGTATTCCCGGGAACGGAT
CTGCCGAACTGTTCTGCTCTTGCTGCCGATATCAAAGCCTGTCAAGCGAAAGGAAAAATCCTCACGCTGAGTTTA
GGCGGTGCCACCGGGTCGGTGGGCTTCCAATCCGACGGTCAGGCGGAGACTTTTGCGGAAACCATTTGGAATTTG
TTCTTGGGAGGCTCTTCTTCTACTCGCCCTTTTGGTAGTGCAAGTCTCGACGGTATTGACTTGGACATTGAGGGT
GGATCATCGGCCCATTATGCTGCTTTCGTCAACAAAATCCGTTCTCTTGCAAGCGGTGCAAGCAAGAAGTATTAC
GTGACTGCTGCACCGCAATGTGTGTATCCCGATTCAGCTCTTGGTGGTGTTTTGAATTCCGCGCATTTCGATGCT
ATCTATGGTAAATTTTACAATAACCCTTGTGGTCTCCAGAACTTCAATTCTGTTTCGAATTGGAACTTTGGTATT
TGGGACAATTGGGCTCGGACCATTAGCCCGAACAAAGACGTCAAAGTCTACATCGGTGCTCCTGCTTCCAGTTCA
GCAGCTGGAGGAGGTTACGTCGACTCAACTACTTTGAGAAACATTGCGAATAAAATGCGCAGAAGTTTCCCATCT
TTCGGCGGAGTCATGCTTTGGGATGCTTCACAAGCTTACGCAAATAACCGGTATGATCAAGCAATTAAGAATGGC
TTGACTTCCGCAGGTGGAACGGGTTTCACATTCCCACCATGTTCTGCTCCTACGTACTCGGCTGGCGAGGTCTAC
GTAGGTGGCCTGCAGGCCTCCTTTGGAGGGTACATCTGGCAGTCAAAATGGTGGACAAACTCCCAACCAGCACAT
AATCCATTCGGCGACTGGAGCGCGATCAGCGCCTGTCGATAA
Transcript >AgabiH39|011100
ATGATGCTGAACATTGCTCGGACTTTCATAGTTCTTGCTTTTTCGACTTGGTTGGCCGATGCCTTCGACAACAGT
CGTTTCGATAACTTGGCAGTATATTGGGGCCAGAATTCCTACGGGGCCGGTCATAGTGATACAGCAAACTGGCAG
AAGCCGGTATCCTTCTATTGCAATGATGATGCGATAAACGTCTTCCCTGTAGCTTTCCTACATGTCTTTTTTGGG
CCCGGCGGCCTTCCTTCCATCAACTTGGCCAATACCTGTAATGATAAAGACAACAGTGTATTCCCGGGAACGGAT
CTGCCGAACTGTTCTGCTCTTGCTGCCGATATCAAAGCCTGTCAAGCGAAAGGAAAAATCCTCACGCTGAGTTTA
GGCGGTGCCACCGGGTCGGTGGGCTTCCAATCCGACGGTCAGGCGGAGACTTTTGCGGAAACCATTTGGAATTTG
TTCTTGGGAGGCTCTTCTTCTACTCGCCCTTTTGGTAGTGCAAGTCTCGACGGTATTGACTTGGACATTGAGGGT
GGATCATCGGCCCATTATGCTGCTTTCGTCAACAAAATCCGTTCTCTTGCAAGCGGTGCAAGCAAGAAGTATTAC
GTGACTGCTGCACCGCAATGTGTGTATCCCGATTCAGCTCTTGGTGGTGTTTTGAATTCCGCGCATTTCGATGCT
ATCTATGGTAAATTTTACAATAACCCTTGTGGTCTCCAGAACTTCAATTCTGTTTCGAATTGGAACTTTGGTATT
TGGGACAATTGGGCTCGGACCATTAGCCCGAACAAAGACGTCAAAGTCTACATCGGTGCTCCTGCTTCCAGTTCA
GCAGCTGGAGGAGGTTACGTCGACTCAACTACTTTGAGAAACATTGCGAATAAAATGCGCAGAAGTTTCCCATCT
TTCGGCGGAGTCATGCTTTGGGATGCTTCACAAGCTTACGCAAATAACCGGTATGATCAAGCAATTAAGAATGGC
TTGACTTCCGCAGGTGGAACGGGTTTCACATTCCCACCATGTTCTGCTCCTACGTACTCGGCTGGCGAGGTCTAC
GTAGGTGGCCTGCAGGCCTCCTTTGGAGGGTACATCTGGCAGTCAAAATGGTGGACAAACTCCCAACCAGCACAT
AATCCATTCGGCGACTGGAGCGCGATCAGCGCCTGTCGATAA
Gene >AgabiH39|011100
ATGATGCTGAACATTGCTCGGACTTTCATAGTTCTTGCTTTTTCGACTTGGTTGGCCGATGCCTTCGACAACAGT
CGTTTCGATAACGTATATTTTCCCGTCAATTCTTCATTTCTCAGCTGACGCGAAGACGTTGTTCACAGTTGGCAG
TGTAAGTTCTTTAATCGAATGGTCATACTCAAGCATCTAACTGGGGTCAATCCAGATATTGGGGCCAGAATTCCT
ACGGGGCCGGTCATAGTGATACAGCAAACTGGCAGAAGCCGGTATCCTTCTATTGCAATGCAAGTCATTTTTGAT
GGTATCATCTCATTTTCTGACAATGACCCAAACGTTACTTAGGATGATGCGATAAACGTCTTCCCTGTAGCTTTC
CTACATGTCTTTTTTGGGCCCGGCGGCCTTCCTTCCATCAACTTGGCCAATGTAGGTCGATCTCAAACCCAGCAT
TGATCAAGCAATTTGACGTTTCGCCCAGACCTGTAATGATAAAGACAACAGTGTATTCCCGGGAACGGATCTGCC
GAACTGTTCTGCTCTTGCTGCCGATATCAAAGCCTGTCAAGCGAAAGGAAAAATCCTCACGCTGAGTTTAGGCGG
TGCCACCGGGTCGGTGGGCTTCCAATCCGACGGTCAGGCGGAGACTTTTGCGGAAACCATTTGGAATTTGTTCTT
GGGAGGCTCTTCTTCTACTCGCCCTTTTGGTAGTGCAAGTCTCGACGGGTAAGCCGTTGCTTAAGCCGCTTCTAA
TCTGAGCTTATCCAATGCTAGTATTGACTTGGACATTGAGGGTGGATCATCGGCCCATTATGCTGCTTTCGTCAA
CAAAATCCGTTCTCTTGCAAGCGGTGCAAGCAAGAAGTGAGATTTTCTTTCCCAGCATAGCTTGTCGTTCAACGA
TAGCACACAGGTATTACGTGACTGCTGCACCGCAATGTGTGTATCCCGATTCAGCTCTTGGTGGTGTTTTGAATT
CCGCGCATTTCGATGCTATCTATGGTAAGTATTTTTAACGCCTACTCCACGAACTTTCTTTTCTGACAACTTCTG
AAGTTCAGTCAGTGTTAACCATCTTCCTCACTTTTTGTCCAGAACATAACGCCTTGTCACAGATTTTACAATAAC
CCTTGTGGTCTCCAGAACTTCAATTCTGTTTCGGTTAGTCTGTTCAACGTCAACATCGACTCCATCTGAAGCTAA
ACTTTAAAAACTATAGAATTGGAACTTTGGTATTTGGTAAGGGAATTCCCCTCCCATGTGAGGCATAAAATGACA
AGTGGGAATCAAGGGACAATTGGGCTCGGACCATTAGCCCGAACAAAGACGTCAAAGTCTACATCGGTGCTCCTG
CTTCCAGTTCAGCAGCTGGAGGAGGTTACGTCGACTCAACTACTTTGAGAAACATTGCGAATAAAATGCGCAGAA
GTTTCCCATCTTTCGGCGGAGTCATGCTTTGGGATGCTTCACAAGCTTACGGTAACTTTCCCTTCGATTCCTATT
GATGATAGCCTTGTTCAAGGGATTATTTAGCAAATAACCGGTATGATCAAGCAATTAAGAATGGCTTGACTTCCG
CAGGTGGAACGGGTTTCACATTCCCACCATGTTCTGCTCCTACGTACTCGGCTGGCGAGGTCTACGTAGGTGGCC
TGCAGGCCTCCTTTGGAGGGTGAGTTTTGATTCCACAAAACTACAGGTTGAATGCCGAACTCATCTGAACTCGCT
TAGGTACATCTGGCAGGTAAATAATTACTCTCGCGATACTCTCTGAAAAAGGTCACTCACAGTAACTTAGTCAAA
ATGGTGGACAAACTCCCAACCAGCACATAATCCATTCGGCGACTGGAGCGCGAGTATGTGTTATGTTTTTATTCG
TGCTCTTACCAAATTTATCACTGATGAACCTTTTTTCCAGTCAGCGCCTGTCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail