Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|010270
Gene name
Locationscaffold_01:2464480..2466192
Strand+
Gene length (bp)1712
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999625

Transmembrane Domains

Domain # Start End Length
1 268 290 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup920
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|010250
Agaricus bisporus var bisporus H39 AgabiH39|010260
Agaricus bisporus var bisporus H39 AgabiH39|010270 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|010250
Agaricus bisporus var bisporus H97 AgabiH97|010260
Agaricus bisporus var bisporus H97 AgabiH97|010270
Rhodonia placenta FPRL280 RhoplFPRL280|1_80

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|010270
MGSIPFRSSIIYFALFFQQVHGFTFITSQPTQCGELRFNWVGGTPPFTALVIAPFDIIRNISIPAQAWNERDQSG
DYSYLLNFNQSQKVVFSMGDATGPTTGGVTDVTTVGAPTQGSPPCTTSKHGPDFTFATTLPLSQCKNFSFGQLGS
AVQPISVLVTVPHGESFMLTAPLGDPFIWKANLTAGTNVIFTVKDAQNRLGGTSHILNVGTSDDSSCLGSPPISV
PPTRLPGVPTTSSLNPQHINTSSSSPTDSGSKNNHTDNKTGVIVGASVGGTVALLLTMALVYCLIRRKGGRNGIK
HIDLTGSTPGVSTSFMYHGHVAPTPYFVSSTGVVASQTTRNNGFPSASSTLTNIGTGPHVRNSSTAAAALAGTES
LAGTTDTEANHSVVSFKREVLQQRDGQLHLYFDPYAKNWWQQQDYDFEPYADATSHSQRIGSTSASGAGPASNPG
TTSRYSGATSP*
Coding >AgabiH39|010270
ATGGGCTCTATACCCTTTCGTTCATCCATTATTTATTTCGCTCTCTTTTTCCAGCAGGTCCATGGATTCACCTTC
ATTACCTCCCAGCCGACACAGTGTGGCGAACTGCGGTTCAATTGGGTCGGCGGTACACCGCCATTCACTGCTCTC
GTAATAGCGCCATTTGATATAATACGGAATATCAGTATCCCAGCGCAAGCGTGGAACGAACGAGACCAATCGGGA
GATTATTCGTATCTTCTCAATTTCAATCAAAGTCAGAAGGTCGTGTTTTCAATGGGTGATGCAACCGGACCCACC
ACAGGTGGAGTTACAGATGTTACCACTGTCGGAGCACCCACCCAAGGTTCGCCGCCGTGCACTACAAGCAAACAT
GGTCCCGATTTTACTTTCGCAACCACTTTACCACTTTCACAGTGCAAGAATTTTTCCTTCGGTCAGTTGGGTTCT
GCAGTGCAGCCAATATCAGTGCTTGTAACCGTACCTCACGGCGAATCCTTCATGTTGACCGCACCTCTCGGGGAT
CCTTTTATCTGGAAAGCTAACTTGACGGCGGGAACCAACGTTATCTTCACTGTGAAAGACGCTCAGAACCGCTTG
GGGGGTACGAGCCATATCCTCAACGTTGGCACATCGGATGATTCTTCGTGTTTGGGATCCCCTCCGATATCTGTC
CCACCTACTCGTTTGCCAGGAGTACCCACTACTTCATCACTCAACCCACAACATATAAATACGTCTTCCAGTAGC
CCAACTGATTCAGGAAGCAAGAATAACCACACAGATAACAAAACGGGGGTTATTGTCGGCGCCTCTGTCGGTGGA
ACTGTCGCACTTCTACTCACAATGGCACTCGTCTATTGTTTGATCAGACGGAAAGGTGGACGCAATGGCATCAAA
CACATTGACTTAACCGGATCAACTCCAGGCGTTTCTACATCTTTCATGTATCATGGTCATGTCGCACCCACTCCT
TACTTCGTCAGTTCAACGGGTGTAGTAGCATCACAGACGACCCGCAATAATGGTTTTCCTTCAGCTTCATCAACG
CTGACCAACATTGGGACCGGTCCCCATGTTAGAAATTCCTCTACAGCAGCGGCAGCCCTTGCGGGGACTGAGTCT
CTAGCTGGTACCACAGATACTGAGGCTAACCACTCTGTAGTGAGCTTCAAACGGGAGGTGTTGCAGCAACGGGAT
GGTCAGCTACACCTGTATTTTGATCCTTACGCAAAGAACTGGTGGCAGCAGCAGGACTATGATTTCGAACCGTAC
GCCGACGCAACATCTCATTCGCAGAGAATAGGAAGTACGTCAGCGTCTGGTGCTGGTCCGGCATCTAATCCTGGT
ACCACATCGAGATATAGTGGGGCCACATCGCCATAA
Transcript >AgabiH39|010270
ATGGGCTCTATACCCTTTCGTTCATCCATTATTTATTTCGCTCTCTTTTTCCAGCAGGTCCATGGATTCACCTTC
ATTACCTCCCAGCCGACACAGTGTGGCGAACTGCGGTTCAATTGGGTCGGCGGTACACCGCCATTCACTGCTCTC
GTAATAGCGCCATTTGATATAATACGGAATATCAGTATCCCAGCGCAAGCGTGGAACGAACGAGACCAATCGGGA
GATTATTCGTATCTTCTCAATTTCAATCAAAGTCAGAAGGTCGTGTTTTCAATGGGTGATGCAACCGGACCCACC
ACAGGTGGAGTTACAGATGTTACCACTGTCGGAGCACCCACCCAAGGTTCGCCGCCGTGCACTACAAGCAAACAT
GGTCCCGATTTTACTTTCGCAACCACTTTACCACTTTCACAGTGCAAGAATTTTTCCTTCGGTCAGTTGGGTTCT
GCAGTGCAGCCAATATCAGTGCTTGTAACCGTACCTCACGGCGAATCCTTCATGTTGACCGCACCTCTCGGGGAT
CCTTTTATCTGGAAAGCTAACTTGACGGCGGGAACCAACGTTATCTTCACTGTGAAAGACGCTCAGAACCGCTTG
GGGGGTACGAGCCATATCCTCAACGTTGGCACATCGGATGATTCTTCGTGTTTGGGATCCCCTCCGATATCTGTC
CCACCTACTCGTTTGCCAGGAGTACCCACTACTTCATCACTCAACCCACAACATATAAATACGTCTTCCAGTAGC
CCAACTGATTCAGGAAGCAAGAATAACCACACAGATAACAAAACGGGGGTTATTGTCGGCGCCTCTGTCGGTGGA
ACTGTCGCACTTCTACTCACAATGGCACTCGTCTATTGTTTGATCAGACGGAAAGGTGGACGCAATGGCATCAAA
CACATTGACTTAACCGGATCAACTCCAGGCGTTTCTACATCTTTCATGTATCATGGTCATGTCGCACCCACTCCT
TACTTCGTCAGTTCAACGGGTGTAGTAGCATCACAGACGACCCGCAATAATGGTTTTCCTTCAGCTTCATCAACG
CTGACCAACATTGGGACCGGTCCCCATGTTAGAAATTCCTCTACAGCAGCGGCAGCCCTTGCGGGGACTGAGTCT
CTAGCTGGTACCACAGATACTGAGGCTAACCACTCTGTAGTGAGCTTCAAACGGGAGGTGTTGCAGCAACGGGAT
GGTCAGCTACACCTGTATTTTGATCCTTACGCAAAGAACTGGTGGCAGCAGCAGGACTATGATTTCGAACCGTAC
GCCGACGCAACATCTCATTCGCAGAGAATAGGAAGTACGTCAGCGTCTGGTGCTGGTCCGGCATCTAATCCTGGT
ACCACATCGAGATATAGTGGGGCCACATCGCCATAA
Gene >AgabiH39|010270
ATGGGCTCTATACCCTTTCGTTCATCCATTATTTATTTCGCTCTCTTTTTCCAGCAGGTCCATGGATTCACCTTC
ATTACCTCCCAGCCGACACAGTGTGGCGAACTGCGGTTCAATTGGGTCGGTGAGTCATTAGAGCAGAAGACAGCG
CTGCTGTCTTTCTATGATTGACATCAAGAGTCAATCGGGGATTAACTCAGAAATTAATATGCATATTCATTGGCT
TCGCAGGCGGTACACCGCCATTCACTGCTCTCGTAATAGCGGTACGCTTCTTTCAAGTGGATATACTCGTAGACT
GATTGTTAATGCAGCCATTTGATATAATACGGAATATCAGTATCCCAGCGCAAGCGTGGAACGAACGAGACCAAT
CGGGAGATTATTCGTATCTTCTCAATTTCAATCAAAGTCAGAAGGTCGTGTTTTCAATGGGTGATGCAACCGGAC
CCACCACAGGTGGAGTTACAGATGTTACCACTGTCGGAGCACCCACCCAAGGTTCGCCGCCGTGCACTACAAGCA
AACATGGTAGGCTCAAATAATCATGGGGTATATATATTTTGCGAGTCGGGATTTTCGCAGGTCCCGATTTTACTT
TCGCAACCACTTTACCACTTTCACAGTGCAAGTGAGTTCTCCTCCACCTATCTCGCTACGTATTACGGTCTTATT
GGGCATACTTAGGAATTTTTCCTTCGGTCAGTTGGGTTCTGCAGTGCAGCCAATATCAGTGCTTGTTTGTCACAT
CGTACTTTCTTTTTCCGTGGCCGTAGACGCTCATGTTTTTTTTTCTACAGGTAACCGTACCTCACGGCGAATCCT
TCATGTTGACCGCACCTCTCGGGGATCCTTTTATCTGGAAAGCTAACTTGACGGCGGGAACCAACGTTATCTTCA
CTGTGAAAGACGCTCAGAACCGCTTGGGGGGTACGAGCCATATCCTCAACGTTGGCACATCGGATGATTCTTCGT
GTTTGGGATCCCCTCCGATATCTGTCCCACCTACTCGTTTGCCAGGAGTACCCACTACTTCATCACTCAACCCAC
AACATATAAATACGTCTTCCAGTAGCCCAACTGATTCAGGAAGCAAGAATAACCACACAGATAACAAAACGGGGG
TTATTGTCGGCGCCTCTGTCGGTGGAACTGTCGCACTTCTACTCACAATGGCACTCGTCTATTGTTTGATCAGAC
GGAAAGGTGGACGCAATGGCATCAAACACATTGACTTAACCGGATCAACTCCAGGCGTTTCTACATCTTTCATGT
ATCATGGTCATGTCGCACCCACTCCTTACTTCGTCAGTTCAACGGGTGTAGTAGCATCACAGACGACCCGCAATA
ATGGTTTTCCTTCAGCTTCATCAACGCTGACCAACATTGGGACCGGTCCCCATGTTAGAAATTCCTCTACAGCAG
CGGCAGCCCTTGCGGGGACTGAGTCTCTAGCTGGTACCACAGATACTGAGGCTAACCACTCTGTAGTGAGCTTCA
AACGGGAGGTGTTGCAGCAACGGGATGGTCAGCTACACCTGTATTTTGATCCTTACGCAAAGAACTGGTGGCAGC
AGCAGGACTATGATTTCGAACCGTACGCCGACGCAACATCTCATTCGCAGAGAATAGGAAGTACGTCAGCGTCTG
GTGCTGGTCCGGCATCTAATCCTGGTACCACATCGAGATATAGTGGGGCCACATCGCCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail