Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|010010
Gene name
Locationscaffold_01:2409806..2412684
Strand+
Gene length (bp)2878
Transcript length (bp)2727
Coding sequence length (bp)2727
Protein length (aa) 909

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 1.1E-09 31 200
PF02469 Fasciclin Fasciclin domain 9.8E-13 221 336
PF02469 Fasciclin Fasciclin domain 1.0E-13 352 484
PF02469 Fasciclin Fasciclin domain 6.0E-11 497 630
PF02469 Fasciclin Fasciclin domain 1.6E-05 647 731

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 186 630 2.0E-22
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 186 638 6.0E-22
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 43 630 8.0E-15
sp|O11780|BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa GN=TGFBI PE=1 SV=1 43 630 7.0E-14
sp|P82198|BGH3_MOUSE Transforming growth factor-beta-induced protein ig-h3 OS=Mus musculus GN=Tgfbi PE=1 SV=1 43 630 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 186 630 2.0E-22
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 186 638 6.0E-22
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 43 630 8.0E-15
sp|O11780|BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa GN=TGFBI PE=1 SV=1 43 630 7.0E-14
sp|P82198|BGH3_MOUSE Transforming growth factor-beta-induced protein ig-h3 OS=Mus musculus GN=Tgfbi PE=1 SV=1 43 630 2.0E-13
sp|Q95215|BGH3_RABIT Transforming growth factor-beta-induced protein ig-h3 OS=Oryctolagus cuniculus GN=TGFBI PE=2 SV=2 55 630 6.0E-11
sp|O94439|FSC1_SCHPO FAS1 domain-containing protein fsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fsc1 PE=3 SV=1 175 633 4.0E-09
sp|Q15063|POSTN_HUMAN Periostin OS=Homo sapiens GN=POSTN PE=1 SV=2 235 718 1.0E-08
sp|Q62009|POSTN_MOUSE Periostin OS=Mus musculus GN=Postn PE=1 SV=2 236 718 4.0E-06
sp|Q8R4U0|STAB2_MOUSE Stabilin-2 OS=Mus musculus GN=Stab2 PE=1 SV=1 216 430 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999704

Transmembrane Domains

Domain # Start End Length
1 857 879 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1010
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|010010 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|010020
Agaricus bisporus var bisporus H97 AgabiH97|010010
Agaricus bisporus var bisporus H97 AgabiH97|010020
Rhodonia placenta FPRL280 RhoplFPRL280|1_82

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|010010
MRLSVCLAALLARPALALSSTITDVLSADPDYEALLRLLQRTRLIPTLNTLPAATLFAPTNDAISKHDLWAHALD
DAFVLTDNVNEQLRQQLFYHMLNFSIAQGPAPEQSPPLHTFDTLLYPHKPLDPPSHEPPPHPPWMPIPSGTLGEK
SQRLRAVLADDNQKGRVAVDAFGKGGADIVKPIVNATNGAVLGISDVLIPPLDLATVVSAQQSLSYFRRIVTPHV
IKFLNSTSELTLFLPVDNAWDQLNKYERIYLESEFASDDLSRIFNMHAVAKTGVKWSDSFTPGINLSTIDGTTLE
VVTTTEGTKVSGGDLVHPDIYASNGVLHLVSSLLIPEGALQITPEKYLLALNCTSFVSMLRSVNLTDLIRDTEQK
YTILAPQDDVLDVLGDSDLPEKGSPELKKLLQYHFVPGHWTAEKLENGMLLETTLEEEGLKGGKQVLSVDVHHSG
KDSKGLQFAGASVIGDPIELDNILVYFLSRPIVPPSDSISTALPSLDLSNFLAALLSSSQSDIIRTTPRTSLLIP
YNSAFKRLGLLVSAHLLSTSYKQDLEKVILHHTLSDVEYSSNLVNGSQQTFQTLEGSDIKLERMDNGTVLISPSG
GWPGMKSRLVPRDTLTQTGVIHELSDILLPRSVDITIGKLMKAAKGSTMTSLFNRAGFEWILNGTAPPDDWSWPD
EKNPGGGIGWTVLCPTDDAFKNHNLTELFANPMRLKSIVMQHIILSPYPKDQRQRLDARHDFEEMYNNQPLVLED
TATYSTLRDNESFYGDIVFKSTGAEEDGTTQFIVGIKDARGTDGSGDWAKVLGWGRSTTSAFPTFEPTQLDSEPA
QMGFSTRAGFIGGAAGGVIQIDRLILPYEPPWWISYGAPSVVGFAGMVAICGFFYGVRIVWGWDTTEATYEPVGG
FGRNDDEE*
Coding >AgabiH39|010010
ATGCGTCTCTCCGTCTGCCTCGCCGCCCTCCTCGCCCGCCCCGCCCTCGCTCTCTCGTCTACCATCACCGACGTC
CTCAGCGCAGACCCCGACTACGAGGCCCTCCTCCGTCTCCTCCAGCGCACGCGTCTCATCCCCACCCTCAACACT
CTTCCCGCAGCTACTCTCTTCGCCCCCACCAATGACGCCATCAGCAAACACGATCTTTGGGCACACGCCCTCGAC
GACGCCTTCGTCCTCACCGACAACGTCAACGAACAACTCCGCCAGCAGCTCTTCTATCATATGCTCAATTTCTCT
ATTGCCCAGGGACCAGCTCCTGAACAGTCTCCACCCCTTCACACTTTCGACACCCTCCTCTATCCCCACAAGCCT
CTAGATCCTCCTTCCCACGAACCCCCACCCCATCCTCCCTGGATGCCCATCCCTTCAGGAACTCTGGGCGAAAAG
TCCCAGCGACTACGCGCAGTCCTAGCCGACGACAACCAGAAAGGCCGGGTCGCCGTTGATGCTTTCGGCAAAGGT
GGTGCCGATATCGTCAAACCTATCGTCAATGCCACGAATGGCGCCGTTCTCGGTATTTCAGATGTCCTAATCCCT
CCCCTAGACCTTGCTACCGTCGTATCTGCGCAACAGTCACTCTCCTATTTCCGTCGCATCGTCACGCCCCACGTC
ATCAAGTTTCTTAATTCGACTTCTGAACTCACCCTGTTCCTCCCGGTTGATAACGCCTGGGACCAACTCAACAAA
TACGAGAGGATATATCTCGAGAGCGAGTTTGCTTCCGACGATCTCAGTCGCATATTTAATATGCATGCCGTTGCA
AAGACAGGCGTAAAGTGGTCTGATTCATTTACCCCAGGCATCAACCTCTCGACGATCGACGGAACAACTCTCGAA
GTAGTCACCACTACCGAGGGTACTAAAGTTTCTGGCGGTGACCTCGTGCACCCAGACATCTATGCTTCCAATGGC
GTCCTTCACCTCGTTTCCTCATTGCTCATTCCCGAAGGCGCATTACAAATTACCCCAGAAAAGTACCTCCTCGCC
CTTAATTGCACATCTTTCGTCTCCATGCTTCGTTCCGTAAACCTTACTGATCTCATCCGTGACACCGAACAGAAA
TATACTATCCTAGCCCCTCAGGATGACGTACTCGATGTCCTTGGTGACAGTGATTTGCCCGAGAAAGGAAGTCCG
GAGCTAAAGAAACTCCTTCAATATCATTTCGTTCCTGGTCACTGGACCGCCGAGAAGCTTGAAAATGGAATGTTG
CTAGAGACGACATTGGAAGAAGAGGGGTTAAAGGGTGGGAAGCAGGTTTTGTCCGTTGATGTCCATCATAGCGGC
AAAGATTCCAAGGGTTTGCAATTTGCTGGAGCCAGTGTCATCGGCGATCCAATCGAACTTGACAACATCTTGGTT
TACTTTCTTTCAAGGCCCATAGTGCCTCCCTCGGATTCCATTTCCACCGCTCTCCCTTCCCTCGACTTGTCCAAC
TTCCTTGCCGCACTCCTTTCTTCCAGCCAATCTGACATCATTAGAACAACACCTCGCACTTCTCTTCTCATTCCG
TACAATTCCGCTTTTAAACGCCTTGGTCTCCTTGTCAGCGCACATCTTCTCAGTACATCCTACAAACAAGATCTT
GAAAAAGTCATTCTGCACCACACACTCTCCGATGTCGAGTACTCGAGCAACCTCGTTAATGGCTCTCAACAAACT
TTTCAAACGTTGGAAGGTAGCGATATCAAACTTGAACGTATGGACAACGGTACCGTTCTCATTAGCCCAAGTGGT
GGCTGGCCTGGCATGAAATCGCGTCTTGTTCCACGAGACACTTTGACTCAGACGGGTGTCATCCATGAGTTGTCC
GATATACTCCTGCCGAGGTCGGTCGACATTACGATCGGGAAACTCATGAAAGCTGCCAAAGGAAGTACTATGACA
AGTCTGTTCAATCGTGCCGGCTTTGAATGGATTCTGAATGGAACTGCGCCACCGGATGACTGGTCATGGCCTGAT
GAGAAGAATCCCGGCGGTGGTATTGGTTGGACGGTGCTGTGTCCCACGGACGATGCCTTTAAGAACCACAATCTC
ACTGAACTCTTCGCTAATCCCATGAGATTGAAATCCATTGTCATGCAACATATCATTCTTTCCCCTTATCCTAAA
GACCAACGTCAACGATTAGACGCTAGACATGATTTTGAGGAGATGTACAACAACCAGCCTTTGGTTCTGGAAGAT
ACCGCCACCTATTCGACTCTGAGGGACAATGAATCGTTTTACGGGGATATTGTGTTTAAGTCTACGGGAGCGGAA
GAGGACGGTACGACGCAATTCATCGTTGGGATCAAAGACGCACGAGGTACAGATGGCTCCGGAGATTGGGCCAAA
GTTTTGGGATGGGGTCGGAGCACAACTTCCGCTTTCCCTACCTTTGAACCCACACAATTAGATTCCGAACCCGCG
CAAATGGGATTCTCGACAAGGGCAGGATTTATCGGGGGTGCAGCTGGCGGTGTGATTCAAATTGATAGACTCATT
TTACCTTACGAGCCTCCTTGGTGGATTTCTTATGGTGCACCATCGGTGGTTGGATTTGCGGGTATGGTCGCGATA
TGTGGTTTCTTTTATGGTGTTCGAATTGTTTGGGGTTGGGATACGACTGAGGCGACGTATGAACCTGTTGGTGGA
TTTGGGAGAAATGATGATGAGGAATAG
Transcript >AgabiH39|010010
ATGCGTCTCTCCGTCTGCCTCGCCGCCCTCCTCGCCCGCCCCGCCCTCGCTCTCTCGTCTACCATCACCGACGTC
CTCAGCGCAGACCCCGACTACGAGGCCCTCCTCCGTCTCCTCCAGCGCACGCGTCTCATCCCCACCCTCAACACT
CTTCCCGCAGCTACTCTCTTCGCCCCCACCAATGACGCCATCAGCAAACACGATCTTTGGGCACACGCCCTCGAC
GACGCCTTCGTCCTCACCGACAACGTCAACGAACAACTCCGCCAGCAGCTCTTCTATCATATGCTCAATTTCTCT
ATTGCCCAGGGACCAGCTCCTGAACAGTCTCCACCCCTTCACACTTTCGACACCCTCCTCTATCCCCACAAGCCT
CTAGATCCTCCTTCCCACGAACCCCCACCCCATCCTCCCTGGATGCCCATCCCTTCAGGAACTCTGGGCGAAAAG
TCCCAGCGACTACGCGCAGTCCTAGCCGACGACAACCAGAAAGGCCGGGTCGCCGTTGATGCTTTCGGCAAAGGT
GGTGCCGATATCGTCAAACCTATCGTCAATGCCACGAATGGCGCCGTTCTCGGTATTTCAGATGTCCTAATCCCT
CCCCTAGACCTTGCTACCGTCGTATCTGCGCAACAGTCACTCTCCTATTTCCGTCGCATCGTCACGCCCCACGTC
ATCAAGTTTCTTAATTCGACTTCTGAACTCACCCTGTTCCTCCCGGTTGATAACGCCTGGGACCAACTCAACAAA
TACGAGAGGATATATCTCGAGAGCGAGTTTGCTTCCGACGATCTCAGTCGCATATTTAATATGCATGCCGTTGCA
AAGACAGGCGTAAAGTGGTCTGATTCATTTACCCCAGGCATCAACCTCTCGACGATCGACGGAACAACTCTCGAA
GTAGTCACCACTACCGAGGGTACTAAAGTTTCTGGCGGTGACCTCGTGCACCCAGACATCTATGCTTCCAATGGC
GTCCTTCACCTCGTTTCCTCATTGCTCATTCCCGAAGGCGCATTACAAATTACCCCAGAAAAGTACCTCCTCGCC
CTTAATTGCACATCTTTCGTCTCCATGCTTCGTTCCGTAAACCTTACTGATCTCATCCGTGACACCGAACAGAAA
TATACTATCCTAGCCCCTCAGGATGACGTACTCGATGTCCTTGGTGACAGTGATTTGCCCGAGAAAGGAAGTCCG
GAGCTAAAGAAACTCCTTCAATATCATTTCGTTCCTGGTCACTGGACCGCCGAGAAGCTTGAAAATGGAATGTTG
CTAGAGACGACATTGGAAGAAGAGGGGTTAAAGGGTGGGAAGCAGGTTTTGTCCGTTGATGTCCATCATAGCGGC
AAAGATTCCAAGGGTTTGCAATTTGCTGGAGCCAGTGTCATCGGCGATCCAATCGAACTTGACAACATCTTGGTT
TACTTTCTTTCAAGGCCCATAGTGCCTCCCTCGGATTCCATTTCCACCGCTCTCCCTTCCCTCGACTTGTCCAAC
TTCCTTGCCGCACTCCTTTCTTCCAGCCAATCTGACATCATTAGAACAACACCTCGCACTTCTCTTCTCATTCCG
TACAATTCCGCTTTTAAACGCCTTGGTCTCCTTGTCAGCGCACATCTTCTCAGTACATCCTACAAACAAGATCTT
GAAAAAGTCATTCTGCACCACACACTCTCCGATGTCGAGTACTCGAGCAACCTCGTTAATGGCTCTCAACAAACT
TTTCAAACGTTGGAAGGTAGCGATATCAAACTTGAACGTATGGACAACGGTACCGTTCTCATTAGCCCAAGTGGT
GGCTGGCCTGGCATGAAATCGCGTCTTGTTCCACGAGACACTTTGACTCAGACGGGTGTCATCCATGAGTTGTCC
GATATACTCCTGCCGAGGTCGGTCGACATTACGATCGGGAAACTCATGAAAGCTGCCAAAGGAAGTACTATGACA
AGTCTGTTCAATCGTGCCGGCTTTGAATGGATTCTGAATGGAACTGCGCCACCGGATGACTGGTCATGGCCTGAT
GAGAAGAATCCCGGCGGTGGTATTGGTTGGACGGTGCTGTGTCCCACGGACGATGCCTTTAAGAACCACAATCTC
ACTGAACTCTTCGCTAATCCCATGAGATTGAAATCCATTGTCATGCAACATATCATTCTTTCCCCTTATCCTAAA
GACCAACGTCAACGATTAGACGCTAGACATGATTTTGAGGAGATGTACAACAACCAGCCTTTGGTTCTGGAAGAT
ACCGCCACCTATTCGACTCTGAGGGACAATGAATCGTTTTACGGGGATATTGTGTTTAAGTCTACGGGAGCGGAA
GAGGACGGTACGACGCAATTCATCGTTGGGATCAAAGACGCACGAGGTACAGATGGCTCCGGAGATTGGGCCAAA
GTTTTGGGATGGGGTCGGAGCACAACTTCCGCTTTCCCTACCTTTGAACCCACACAATTAGATTCCGAACCCGCG
CAAATGGGATTCTCGACAAGGGCAGGATTTATCGGGGGTGCAGCTGGCGGTGTGATTCAAATTGATAGACTCATT
TTACCTTACGAGCCTCCTTGGTGGATTTCTTATGGTGCACCATCGGTGGTTGGATTTGCGGGTATGGTCGCGATA
TGTGGTTTCTTTTATGGTGTTCGAATTGTTTGGGGTTGGGATACGACTGAGGCGACGTATGAACCTGTTGGTGGA
TTTGGGAGAAATGATGATGAGGAATAG
Gene >AgabiH39|010010
ATGCGTCTCTCCGTCTGCCTCGCCGCCCTCCTCGCCCGCCCCGCCCTCGCTCTCTCGTCTACCATCACCGACGTC
CTCAGCGCAGACCCCGACTACGAGGCCCTCCTCCGTCTCCTCCAGCGCACGCGTCTCATCCCCACCCTCAACACT
CTTCCCGCAGCTACTCTCTTCGCCCCCACCAATGACGCCATCAGCAAACACGATCTTTGGGCACACGCCCTCGAC
GACGCCTTCGTCCTCACCGACAACGTCAACGAACAACTCCGCCAGCAGCTCTTCTATCATATGCTCAATTTCTCT
ATTGCCCAGGGACCAGCTCCTGAACAGTCTCCACCCCTTCACACTTTCGACACCCTCCTCTATCCCCACAAGCCT
CTAGATCCTCCTTCCCACGAACCCCCACCCCATCCTCCCTGGATGCCCATCCCTTCAGGAACTCTGGGCGAAAAG
TCCCAGCGACTACGCGCAGTCCTAGCCGACGACAACCAGAAAGGCCGGGTCGCCGTTGATGCTTTCGGCAAAGGT
GGTGCCGATATCGTCAAACCTATCGTCAATGCCACGAATGGCGCCGTTCTCGGTATTTCAGATGTCCTAATCCCT
CCCCTAGACCTTGGTATGTCTCCGCATTAACCGTGCCCCGCTCGTCCTCATGCTGTTCTAGCTACCGTCGTATCT
GCGCAACAGTCACTCTCCTATTTCCGTCGCATCGTCACGCCCCACGTCATCAAGTTTCTTAATTCGACTTCTGAA
CTCACCCTGTTCCTCCCGGTTGATAACGCCTGGGACCAACTCAACAAATACGAGAGGATATATCTCGAGAGCGAG
TTTGCTTCCGACGATCTCAGTCGCATATTTAATATGCATGCCGTTGCAAAGACAGGCGTAAAGTGGTCTGATTCA
TTTACCCCAGGCATCAACCGTAATTCAGTCCAGTTCAGTCCTTGCAGACCCCTCGCTAACACGCGTCTATAGTCT
CGACGATCGACGGAACAACTCTCGAAGTAGTCACCACTACCGAGGGTACTAAAGTTTCTGGCGGTGACCTCGTGC
ACCCAGACATCTATGCTTCCAATGGCGTCCTTCACCTCGTTTCCTCATTGCTCATTCCCGAAGGCGCATTACAAA
TTACCCCAGAAAAGTACCTCCTCGCCCTTAATTGCACATCTTTCGTCTCCATGCTTCGTTCCGTAAACCTTACTG
ATCTCATCCGTGACACCGAACAGAAATATACTATCCTAGCCCCTCAGGATGACGTACTCGATGTCCTTGGTGACA
GTGATTTGCCCGAGAAAGGAAGTCCGGAGCTAAAGAAACTCCTTCAATATCATTTCGTTCCTGGTCACTGGACCG
CCGAGAAGCTTGAAAATGGAATGTTGCTAGAGACGACATTGGAAGAAGAGGGGTTAAAGGGTGGGAAGCAGGTTT
TGTCCGTTGATGTCCATCATAGCGGCAAAGATTCCAAGGGTTTGCAATTTGCTGGAGCCAGTGTCATCGGCGATC
CAAGTAAGCTTTGATAACTTTTATGCAAAGTGAGATGCTCATAGTCTCGGCAGTCGAACTTGACAACATCTTGGT
TTACTTTCTTTCAAGGCCCATAGTGCCTCCCTCGGATTCCATTTCCACCGCTCTCCCTTCCCTCGACTTGTCCAA
CTTCCTTGCCGCACTCCTTTCTTCCAGCCAATCTGACATCATTAGAACAACACCTCGCACTTCTCTTCTCATTCC
GTACAATTCCGCTTTTAAACGCCTTGGTCTCCTTGTCAGCGCACATCTTCTCAGTACATCCTACAAACAAGATCT
TGAAAAAGTCATTCTGCACCACACACTCTCCGATGTCGAGTACTCGAGCAACCTCGTTAATGGCTCTCAACAAAC
TTTTCAAACGTTGGAAGGTAGCGATATCAAACTTGAACGTATGGACAACGGTACCGTTCTCATTAGCCCAAGTGG
TGGCTGGCCTGGCATGAAATCGCGTCTTGTTCCACGAGACACTTTGACTCAGACGGGTGTCATCCATGAGTTGTC
CGATATACTCCTGCCGAGGTCGGTCGACATTACGATCGGGAAACTCATGAAAGCTGCCAAAGGAAGTACTATGAC
AAGTCTGTTCAATCGTGCCGGCTTTGAATGGATTCTGAATGGAACTGCGCCACCGGATGACTGGTCATGGCCTGA
TGAGAAGAATCCCGGCGGTGGTATTGGTTGGACGGTGCTGTGTCCCACGGACGATGCCTTTAAGAACCACAATCT
CACTGAACTCTTCGCTAATCCCATGAGATTGAAATCCATTGTCATGCAACATATCATTCTTTCCCCTTATCCTAA
AGACCAACGTCAACGATTAGACGCTAGACATGATTTTGAGGAGATGTACAACAACCAGCCTTTGGTTCTGGAAGA
TACCGCCACCTATTCGACTCTGAGGGACAATGAATCGTTTTACGGGGATATTGTGTTTAAGTCTACGGGAGCGGA
AGAGGACGGTACGACGCAATTCATCGTTGGGATCAAAGACGCACGAGGTACAGATGGCTCCGGAGATTGGGCCAA
AGTTTTGGGATGGGGTCGGAGCACAACTTCCGCTTTCCCTACCTTTGAACCCACACAATTAGATTCCGAACCCGC
GCAAATGGGATTCTCGACAAGGGCAGGATTTATCGGGGGTGCAGCTGGCGGTGTGATTCAAATTGATAGACTCAT
TTTACCTTACGAGCCTCCTTGGTGGATTTCTTATGGTGCACCATCGGTGGTTGGATTTGCGGGTATGGTCGCGAT
ATGTGGTTTCTTTTATGGTGTTCGAATTGTTTGGGGTTGGGATACGACTGAGGCGACGTATGAACCTGTTGGTGG
ATTTGGGAGAAATGATGATGAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail