Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|007910
Gene name
Locationscaffold_01:1920389..1922685
Strand+
Gene length (bp)2296
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.0E-66 36 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 27 433 8.0E-79
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 28 431 3.0E-74
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 27 431 1.0E-71
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 27 427 5.0E-68
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 27 427 8.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 27 433 8.0E-79
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 28 431 3.0E-74
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 27 431 1.0E-71
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 27 427 5.0E-68
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 27 427 8.0E-66
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 27 427 1.0E-65
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 15 433 4.0E-62
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 15 433 1.0E-60
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 24 427 2.0E-60
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 24 427 1.0E-59
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 15 433 1.0E-56
sp|Q9SFW5|AEE21_ARATH Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 15 433 3.0E-55
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 24 427 6.0E-55
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 27 427 4.0E-46
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 21 432 1.0E-39
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 51 422 1.0E-30
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 57 417 1.0E-28
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 32 433 1.0E-25
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 32 433 2.0E-25
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 28 433 6.0E-25
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 28 433 6.0E-25
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 32 427 2.0E-23
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 38 443 3.0E-23
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 59 428 3.0E-22
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 38 443 4.0E-22
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 59 433 6.0E-22
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 38 443 6.0E-22
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 38 443 2.0E-21
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 38 443 2.0E-21
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 38 443 3.0E-21
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 38 443 3.0E-21
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 38 443 3.0E-21
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 38 443 5.0E-21
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 38 443 6.0E-21
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 38 443 6.0E-21
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 38 443 7.0E-21
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 38 443 7.0E-21
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 38 443 7.0E-21
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 23 429 1.0E-20
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 38 443 3.0E-20
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 32 427 1.0E-19
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 32 426 1.0E-19
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 35 426 2.0E-19
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 38 443 2.0E-19
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 38 443 2.0E-19
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 38 443 2.0E-19
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 38 443 2.0E-19
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 38 443 2.0E-19
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 38 443 2.0E-19
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 32 427 4.0E-19
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 38 443 6.0E-19
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 32 427 7.0E-19
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 38 443 8.0E-19
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 38 443 1.0E-18
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 38 443 1.0E-18
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 38 443 1.0E-18
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 38 443 2.0E-18
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 32 426 3.0E-18
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 38 443 3.0E-18
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 38 443 5.0E-18
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 38 443 5.0E-18
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 32 433 5.0E-18
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 61 433 5.0E-18
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 38 443 5.0E-18
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 38 443 5.0E-18
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 33 426 6.0E-18
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 32 427 7.0E-18
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 38 443 8.0E-18
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 38 443 8.0E-18
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 38 443 8.0E-18
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 32 427 1.0E-17
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 38 443 2.0E-17
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 59 426 3.0E-17
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 38 443 4.0E-17
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 38 443 5.0E-17
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 38 443 5.0E-17
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 38 443 6.0E-17
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 38 443 6.0E-17
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 32 427 7.0E-17
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 32 427 1.0E-16
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 32 427 2.0E-16
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 32 427 4.0E-16
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 32 424 6.0E-16
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 32 427 1.0E-15
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 32 427 1.0E-15
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 32 427 1.0E-15
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 57 426 2.0E-15
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 58 422 2.0E-15
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 21 422 2.0E-15
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 28 280 2.0E-15
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 37 422 4.0E-15
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 38 427 1.0E-14
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 32 433 4.0E-14
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 38 444 1.0E-13
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 58 427 1.0E-13
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 58 424 1.0E-13
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 58 427 2.0E-13
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 28 427 2.0E-13
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 28 427 2.0E-13
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 28 427 2.0E-13
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 59 433 2.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 32 432 4.0E-13
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 32 433 5.0E-13
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 23 433 5.0E-13
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 32 433 7.0E-13
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 32 338 8.0E-13
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 46 432 9.0E-13
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 38 426 9.0E-13
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 53 423 1.0E-12
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 58 424 2.0E-12
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 33 444 2.0E-12
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 28 427 2.0E-12
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 68 424 3.0E-12
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 83 441 5.0E-12
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 58 423 6.0E-12
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 12 422 1.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 42 431 2.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 65 422 2.0E-11
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 56 422 2.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 79 426 5.0E-11
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 83 426 5.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 42 214 9.0E-11
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 79 418 1.0E-10
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 32 426 1.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 33 433 2.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 58 423 3.0E-10
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 12 243 3.0E-10
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 58 422 4.0E-10
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 31 432 6.0E-10
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 59 424 7.0E-10
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 7 422 7.0E-10
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 73 218 8.0E-10
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 42 310 8.0E-10
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 38 444 9.0E-10
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 20 243 1.0E-09
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 14 263 2.0E-09
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 59 428 3.0E-09
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 59 424 3.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 66 379 3.0E-09
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 34 416 4.0E-09
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 84 342 7.0E-09
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 84 342 7.0E-09
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 84 342 7.0E-09
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 84 342 7.0E-09
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 84 342 7.0E-09
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 79 352 8.0E-09
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 58 424 1.0E-08
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 84 342 1.0E-08
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 84 342 1.0E-08
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 84 342 1.0E-08
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 84 342 1.0E-08
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 84 342 1.0E-08
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 84 342 1.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 36 215 3.0E-08
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 84 342 3.0E-08
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 14 263 5.0E-08
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 58 209 6.0E-08
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 84 342 8.0E-08
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 84 342 8.0E-08
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 33 432 1.0E-07
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 42 253 1.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 50 209 1.0E-07
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 33 340 2.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 59 338 2.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 22 441 2.0E-07
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 84 342 2.0E-07
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 38 209 2.0E-07
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 78 428 3.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 42 240 3.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 42 209 3.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 213 3.0E-07
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 14 426 3.0E-07
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 59 242 4.0E-07
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 42 337 4.0E-07
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 68 257 4.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 38 436 5.0E-07
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 68 257 5.0E-07
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 58 337 5.0E-07
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 38 214 7.0E-07
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 78 352 7.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 38 213 1.0E-06
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 34 250 1.0E-06
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 33 214 1.0E-06
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 58 337 2.0E-06
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 38 241 4.0E-06
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 43 240 6.0E-06
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 59 262 6.0E-06
sp|P38225|FAT1_YEAST Very long-chain fatty acid transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAT1 PE=1 SV=2 78 281 8.0E-06
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 71 263 8.0E-06
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 13 338 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3217
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|007910 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|007910
Rhodonia placenta FPRL280 RhoplFPRL280|117_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|007910
MLPASVPPPSVLYRLRDTQDASISSHPLNPLDFLLRAAQVYPDKVALVHPNVQYPVQYTFATWAQRIQNLAYALL
YTGIKPGDRVAVIAPNSPLIADAHHGVIAARAILTPINTRLKPSEVAYILDHSGASLILVDFEFVHLLPKDINIP
VVISKDTGRHDDPYEEFLSMGRQFSQERSWGGLDAEPDENAAAVLCYTSGTTGKPKGVITSLRSSYLAAIANAHE
CQMTRDSVYLWILPMFHAAGWTFPWASVFSFAKQITLRTVNYTHIWQHIINSGVSHYCGAPTVQIGIVNDPQARK
LPQPVRAIIAGAAPTAHLIEELEKLGFAPVHVYGLTETLGPFTRNYDQPTWKSLPLAERARFMARQGHAFATAQG
VRVVFAVPDEEKNPVLRDVPRDGKTMGEIVTKGNIVMKEYFRDPEATRKAFRASLFWTEVRTSSYRAERMPPVLL
SNKN*
Coding >AgabiH39|007910
ATGCTCCCCGCCAGCGTCCCTCCCCCCAGCGTCCTCTACCGCCTCAGAGACACCCAGGATGCCTCCATCTCTTCC
CATCCCCTGAATCCCCTCGACTTTCTCCTGCGTGCTGCTCAAGTATACCCGGATAAAGTAGCTCTAGTTCACCCC
AACGTCCAATACCCTGTGCAATACACTTTCGCCACCTGGGCTCAGCGCATTCAGAACCTCGCCTATGCTCTCCTA
TATACCGGAATAAAGCCTGGTGATCGTGTTGCCGTTATTGCACCCAATTCGCCTCTTATCGCAGACGCGCATCAT
GGTGTCATTGCTGCCAGAGCCATACTCACCCCAATTAACACCCGCCTGAAGCCTTCTGAAGTCGCATACATCCTT
GACCACAGCGGCGCAAGCCTGATCCTCGTAGACTTTGAGTTTGTCCATCTCTTACCCAAAGACATCAATATTCCT
GTGGTTATTTCAAAGGATACGGGTCGACACGACGATCCTTATGAAGAATTTCTCTCAATGGGACGACAGTTCAGC
CAAGAAAGGTCTTGGGGTGGCTTAGACGCCGAACCGGATGAGAACGCTGCCGCTGTTCTATGCTATACTTCCGGG
ACAACGGGAAAGCCCAAAGGTGTCATCACCTCGTTGAGAAGTTCTTATCTCGCCGCGATCGCAAATGCGCATGAA
TGCCAGATGACCCGTGACTCTGTTTACCTCTGGATTCTTCCCATGTTCCACGCTGCCGGCTGGACATTTCCTTGG
GCAAGCGTGTTTTCATTTGCGAAGCAAATCACACTTAGGACGGTCAATTACACTCACATATGGCAACATATCATT
AACTCTGGCGTCAGTCACTATTGCGGAGCACCCACAGTCCAGATTGGCATTGTAAATGATCCTCAAGCTCGAAAG
CTGCCGCAGCCGGTCAGAGCTATCATTGCTGGTGCTGCACCCACTGCTCATCTGATTGAAGAGCTTGAGAAATTA
GGTTTTGCCCCTGTGCATGTCTATGGCTTAACCGAGACTCTAGGTCCGTTTACTCGGAATTATGACCAACCTACT
TGGAAGTCCTTGCCTTTGGCTGAGCGAGCCCGTTTTATGGCTCGCCAAGGACACGCGTTTGCCACCGCCCAAGGT
GTTCGTGTTGTCTTTGCTGTCCCCGATGAAGAAAAGAATCCAGTCCTTCGTGATGTACCTCGGGATGGCAAGACC
ATGGGCGAGATTGTCACCAAAGGCAATATTGTCATGAAAGAGTATTTCCGTGACCCGGAGGCTACTCGTAAAGCT
TTTCGTGCATCGCTATTCTGGACAGAAGTAAGGACATCATCATATCGGGCGGAGAGAATGCCTCCAGTCTTGCTA
TCGAACAAGAATTAA
Transcript >AgabiH39|007910
ATGCTCCCCGCCAGCGTCCCTCCCCCCAGCGTCCTCTACCGCCTCAGAGACACCCAGGATGCCTCCATCTCTTCC
CATCCCCTGAATCCCCTCGACTTTCTCCTGCGTGCTGCTCAAGTATACCCGGATAAAGTAGCTCTAGTTCACCCC
AACGTCCAATACCCTGTGCAATACACTTTCGCCACCTGGGCTCAGCGCATTCAGAACCTCGCCTATGCTCTCCTA
TATACCGGAATAAAGCCTGGTGATCGTGTTGCCGTTATTGCACCCAATTCGCCTCTTATCGCAGACGCGCATCAT
GGTGTCATTGCTGCCAGAGCCATACTCACCCCAATTAACACCCGCCTGAAGCCTTCTGAAGTCGCATACATCCTT
GACCACAGCGGCGCAAGCCTGATCCTCGTAGACTTTGAGTTTGTCCATCTCTTACCCAAAGACATCAATATTCCT
GTGGTTATTTCAAAGGATACGGGTCGACACGACGATCCTTATGAAGAATTTCTCTCAATGGGACGACAGTTCAGC
CAAGAAAGGTCTTGGGGTGGCTTAGACGCCGAACCGGATGAGAACGCTGCCGCTGTTCTATGCTATACTTCCGGG
ACAACGGGAAAGCCCAAAGGTGTCATCACCTCGTTGAGAAGTTCTTATCTCGCCGCGATCGCAAATGCGCATGAA
TGCCAGATGACCCGTGACTCTGTTTACCTCTGGATTCTTCCCATGTTCCACGCTGCCGGCTGGACATTTCCTTGG
GCAAGCGTGTTTTCATTTGCGAAGCAAATCACACTTAGGACGGTCAATTACACTCACATATGGCAACATATCATT
AACTCTGGCGTCAGTCACTATTGCGGAGCACCCACAGTCCAGATTGGCATTGTAAATGATCCTCAAGCTCGAAAG
CTGCCGCAGCCGGTCAGAGCTATCATTGCTGGTGCTGCACCCACTGCTCATCTGATTGAAGAGCTTGAGAAATTA
GGTTTTGCCCCTGTGCATGTCTATGGCTTAACCGAGACTCTAGGTCCGTTTACTCGGAATTATGACCAACCTACT
TGGAAGTCCTTGCCTTTGGCTGAGCGAGCCCGTTTTATGGCTCGCCAAGGACACGCGTTTGCCACCGCCCAAGGT
GTTCGTGTTGTCTTTGCTGTCCCCGATGAAGAAAAGAATCCAGTCCTTCGTGATGTACCTCGGGATGGCAAGACC
ATGGGCGAGATTGTCACCAAAGGCAATATTGTCATGAAAGAGTATTTCCGTGACCCGGAGGCTACTCGTAAAGCT
TTTCGTGCATCGCTATTCTGGACAGAAGTAAGGACATCATCATATCGGGCGGAGAGAATGCCTCCAGTCTTGCTA
TCGAACAAGAATTAA
Gene >AgabiH39|007910
ATGCTCCCCGCCAGCGTCCCTCCCCCCAGCGTCCTCTACCGCCTCAGAGACACCCAGGATGCCTCCATCTCTTCC
CATCCCCTGGTAGTGCTCTTTCAGTTTATTCTCATCTCTCTCCGTCCTCATGTCTCCTTAGAATCCCCTCGACTT
TCTCCTGCGTGCTGCTCAAGTATACCCGGATAAAGTAGCTCTAGTTCACCCCAACGTCCAATACCCTGTGCAATA
CACTTTCGCCACCTGGTAATCTGTTAGCAACTTTGTTACAAGTATGCATTCTGAGCGGCCAATAGGGCTCAGCGC
ATTCAGAACCTCGCCTATGCTCTCCTATATACCGGAATAAAGCCTGGTGATCGTGTTGCCGTTATTGCACCCAAT
TCGTACGTCTATCATCTTCTCTAACACCTTCGAATCCTTCCGCTGATCTCACACAGGCCTCTTATCGCAGGTGAG
CTTCTAATTGCATCCCATCCAAATATAACACACTCAACAAACCCATCCAAAGACGCGCATCATGGTGTCATTGCT
GCCAGAGCCATACTCACCCCAATTAACACCCGCCTGAAGCCTTCTGAAGTCGCATACATCCTTGACCACAGCGGC
GCAAGCCTGATCCTCGTAGACTTTGAGTTTGTCCATCTCTTACCCAAAGACATCAATATTCCTGTGGTTATTTCA
AAGGATACGGGTCGACACGACGATCCTTATGAAGAATTTCTCTCAATGGGACGACAGTTCAGCCAAGAAAGGTCT
TGGGGTGGCTTAGACGCCGAACCGGATGAGAACGCTGCCGCTGTTCTATGCTATACGTAGGTTTCCTGTCGTCTT
TTCACCACCAGCGCTTCTTGATAAGGTCTTATTAGTTCCGGGACAACGGGAAAGGCAAGCTCGTTTTTTGCATCT
CAGCGACAAGCTGTGACTCACAAACCAGACAGCCCAAAGGTGTCATCACCTCGTTGAGAAGTGTGTAGTGCAGCC
CCACCCGTAACCGCATTCAATTGGAACATATTTCACAGGTTCTTATCTCGCCGCGATCGCAAATGCGCATGAATG
CCAGTGAGTCTGGAACCTGAAAGTGAATGCGACGGCTCAATAATGTCAATAGGATGACCCGTGACTCTGTTTACC
TCTGGTAGGCTTCACGTCATATTGTGCAGGTCTCTTCTGACATTTGATTTGTTCAGGATTCTTCCCATGTTCCAC
GCTGCCGGCTGGACATTTCCTTGGGCAAGCGTGTTTTCATTTGCGAAGCAAGTGGGTTCATACTATTCGTCTATT
CGTCAGACCATAACGTTTCACCAAGATCACACTTAGGACGGTCAATTACACTCACATATGGCAACATATCATTAA
CTCTGGCGTCAGTCACTATTGCGGAGCACCCACAGTCCAGGTTAACTTGTCGCGTTACAAAGCATTTGATCTGGG
TCTCATTTTCACATAGATTGGCATTGTAAATGATCCTCAAGCTCGAAAGCTGCCGCAGCCGGTCAGAGCTATCAT
TGGTACTTCTTCAACAATTCGACAATTCACTAATGATCTCACGTCATACTAGCTGGTGCTGCACCCACTGCTCAT
CTGATTGAAGAGCTTGAGAAATTAGGTTTTGCCCCTGTGCATGTCTATGGCTTAACGTAAGTCTCACTCTATGTT
TCCAAACCTTGAACTAAATTTTCTCCAGCGAGGTACCTAGTCTAATATGATCTCTCGCGCATCTTCAGCCGCTGA
ACAGTACACAGACTCTAGGTCCGTTTACTCGGAATTATGACCAACCTACTTGGAAGTCCTTGCCTTTGGCTGAGC
GAGCCCGTTTTATGGCTCGCCAAGGACACGCGTTTGCCACCGCCCAAGGTGTTCGTGTTGTCTTTGCTGTCCCCG
ATGAAGAAAAGAATCCAGTCCTTCGTGATGTACCTCGGGATGGCAAGACCATGGGCGAGATTGTCACCAAAGGCA
ATATTGTCATGAAAGAGGTTTGTTTCGTGATCAATAGCTCAACCGGATTCATAAGATATCGTTCCAGTATTTCCG
TGACCCGGAGGCTACTCGTAAAGCTTTTCGTGGTGGGTATTTCAAAACGGGCGACCTTGCAGTCATGAATCCAGA
TGGCAGCATCGCTATTCTGGACAGAAGTAAGGACATCATCATATCGGGCGGAGAGGTAAGTAAATGATTTATTGA
TCCGGTCACCCGTCTGATTATAGCACAGAATGCCTCCAGTCTTGCTATCGAACAAGGTCGATGATTCTTCCTTAT
ATACAGATATTGATTTACTCATGACCATTGTTGAATCCAGAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail