Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|006800
Gene name
Locationscaffold_01:1699835..1701340
Strand-
Gene length (bp)1505
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02182 SAD_SRA SAD/SRA domain 3.0E-50 129 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 82 289 2.0E-34
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 134 289 2.0E-34
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 134 289 3.0E-34
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 134 289 3.0E-34
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 115 295 6.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 82 289 2.0E-34
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 134 289 2.0E-34
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 134 289 3.0E-34
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 134 289 3.0E-34
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 115 295 6.0E-33
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 115 295 6.0E-33
sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 126 289 2.0E-32
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 115 284 4.0E-32
sp|B6CHA3|UHRF1_XENLA E3 ubiquitin-protein ligase UHRF1 OS=Xenopus laevis GN=uhrf1 PE=2 SV=1 115 292 8.0E-32
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 115 292 1.0E-31
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 115 284 2.0E-31
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 115 292 3.0E-30
sp|Q96PU4|UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens GN=UHRF2 PE=1 SV=1 115 292 2.0E-29
sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 108 289 2.0E-26
sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 134 289 8.0E-25
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 127 291 2.0E-19
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 120 295 1.0E-17
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 128 291 1.0E-16
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 129 297 2.0E-14
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 115 290 2.0E-12
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 109 291 4.0E-10
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 119 290 6.0E-09
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 115 289 2.0E-08
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 124 291 5.0E-08
sp|Q9FHI0|YDG1_ARATH YDG domain-containing protein At5g47150 OS=Arabidopsis thaliana GN=At5g47150 PE=2 SV=1 120 291 6.0E-08
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 104 290 1.0E-07
sp|Q9LVU3|YDG2_ARATH YDG domain-containing protein At5g47160 OS=Arabidopsis thaliana GN=At5g47160 PE=2 SV=1 117 284 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup524
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|006800 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|024350
Agaricus bisporus var bisporus H97 AgabiH97|006800
Agaricus bisporus var bisporus H97 AgabiH97|024350
Rhodonia placenta FPRL280 RhoplFPRL280|159_10
Rhodonia placenta FPRL280 RhoplFPRL280|261_10

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|006800
MVSPYERQKELQIAKNKELLKSLGLEKPLFEPKEKPRKKATPQKRKRNDEDTENIEPSARKLQRAEDSSESGTLS
TGLRRSSRNAGKAVDYSGERTLSSPQSVIRNKTSGNDGPMGREDGKRIHNPKTYGHIPGIAVGTWWLSRQDCSQD
AVHAPWVGGISGGRQGAYSVALSGGYDDDVDLGYGFTYTGSGGRDLHGTKDKPKNLRTAPQSSDQSFEHSFNQML
KVSSETRNPVRVVRGFKLQSKYAPSEGYRYDGLYVVEKAFMEKGNNAKGYLVCRYVFKRLPDQPPLPVREDYEDL
DSVEEPSAEED*
Coding >AgabiH39|006800
ATGGTGTCCCCCTATGAAAGGCAGAAGGAACTACAAATAGCCAAGAATAAAGAGCTATTGAAAAGTCTCGGTCTC
GAAAAACCTTTATTTGAACCGAAAGAAAAACCCAGGAAAAAAGCTACACCACAAAAGCGCAAGAGAAACGACGAA
GACACGGAAAACATAGAACCCTCAGCACGGAAACTCCAACGCGCTGAAGATTCCAGTGAGAGTGGAACCTTGTCC
ACAGGTCTTCGTCGCAGTTCTCGCAACGCTGGAAAAGCGGTCGATTACTCTGGCGAAAGAACGTTGAGTTCACCT
CAATCTGTCATACGCAACAAAACTTCGGGCAATGATGGGCCTATGGGACGCGAAGATGGAAAGCGCATACATAAC
CCCAAAACATACGGCCACATCCCCGGTATTGCTGTTGGAACATGGTGGCTTTCAAGACAGGATTGTAGCCAGGAT
GCAGTTCATGCGCCGTGGGTAGGTGGTATATCAGGGGGTCGTCAGGGAGCGTACAGTGTCGCCCTCAGCGGAGGT
TACGATGATGACGTCGACCTTGGATATGGATTCACGTACACTGGTTCTGGTGGTCGTGATCTCCATGGGACAAAG
GATAAACCTAAAAATCTTCGTACAGCTCCACAAAGCTCTGACCAAAGTTTTGAGCACTCGTTCAACCAGATGCTG
AAGGTTTCGTCCGAAACCAGAAACCCAGTTCGTGTTGTGCGTGGTTTCAAGCTTCAATCTAAATATGCTCCAAGT
GAAGGATACCGCTACGATGGATTATATGTAGTGGAAAAGGCCTTCATGGAGAAAGGAAACAATGCGAAAGGATAT
CTTGTTTGCAGATACGTATTTAAGCGTTTACCGGATCAACCCCCTTTGCCAGTTAGAGAGGATTACGAAGACTTG
GATTCGGTAGAGGAACCATCGGCGGAAGAAGATTAG
Transcript >AgabiH39|006800
ATGGTGTCCCCCTATGAAAGGCAGAAGGAACTACAAATAGCCAAGAATAAAGAGCTATTGAAAAGTCTCGGTCTC
GAAAAACCTTTATTTGAACCGAAAGAAAAACCCAGGAAAAAAGCTACACCACAAAAGCGCAAGAGAAACGACGAA
GACACGGAAAACATAGAACCCTCAGCACGGAAACTCCAACGCGCTGAAGATTCCAGTGAGAGTGGAACCTTGTCC
ACAGGTCTTCGTCGCAGTTCTCGCAACGCTGGAAAAGCGGTCGATTACTCTGGCGAAAGAACGTTGAGTTCACCT
CAATCTGTCATACGCAACAAAACTTCGGGCAATGATGGGCCTATGGGACGCGAAGATGGAAAGCGCATACATAAC
CCCAAAACATACGGCCACATCCCCGGTATTGCTGTTGGAACATGGTGGCTTTCAAGACAGGATTGTAGCCAGGAT
GCAGTTCATGCGCCGTGGGTAGGTGGTATATCAGGGGGTCGTCAGGGAGCGTACAGTGTCGCCCTCAGCGGAGGT
TACGATGATGACGTCGACCTTGGATATGGATTCACGTACACTGGTTCTGGTGGTCGTGATCTCCATGGGACAAAG
GATAAACCTAAAAATCTTCGTACAGCTCCACAAAGCTCTGACCAAAGTTTTGAGCACTCGTTCAACCAGATGCTG
AAGGTTTCGTCCGAAACCAGAAACCCAGTTCGTGTTGTGCGTGGTTTCAAGCTTCAATCTAAATATGCTCCAAGT
GAAGGATACCGCTACGATGGATTATATGTAGTGGAAAAGGCCTTCATGGAGAAAGGAAACAATGCGAAAGGATAT
CTTGTTTGCAGATACGTATTTAAGCGTTTACCGGATCAACCCCCTTTGCCAGTTAGAGAGGATTACGAAGACTTG
GATTCGGTAGAGGAACCATCGGCGGAAGAAGATTAG
Gene >AgabiH39|006800
ATGGTGTCCCCCTATGAAAGGCAGAAGGAACTACAAATAGCCAAGGCTTGTATTTGATTATACCCTGAAACTTAT
AATCCTGACAAGGACCTCAGAATAAAGAGCTATTGAAAAGTCTCGGTCTCGAAAAACCTTTATTTGAACCGAAAG
AAAAACCCAGGAAAAAAGCTACACCACAAAAGCGCAAGAGAAACGACGAAGACACGGAAAACATAGAACCCTCAG
CACGGAAACTCCAACGCGCTGAAGATTCCAGTGAGAGTGGAACCTTGTCCACAGGTCTTCGTCGCAGTTCTCGCA
ACGCTGGAAAAGCGGTCGATTACTCTGGCGAAAGAACGTTGAGTTCACCTCAATCTGTCATACGCAACAAAACTT
CGGGCAATGATGGGCCTATGGGACGCGAAGATGGAAAGCGCATACATAACCCGTGAGTTGGAAGATTGCACCTCC
CCGGGTTGAATTCCTAATTTCACCAAACTAGCAAAACATACGGCCACATCCCCGGTATTGCTGTTGGAACATGGT
GGCTTTCAAGACAGGATTGTAGCCAGGATGCAGTTCATGCGTAAGTTATTTTATTAGACTTTAACCCATTATTCA
GCGTTGTTTTTTCGATAGGCCGTGGGTAGGTGGTATATCAGGGGGTCGTCAGGGAGCGTACAGTGTCGCCCTCAG
CGGAGGTTACGATGATGACGTCGACCTTGGATATGGATTGTAAGTTTTTTTTTTTCTATGGCACTGATGTATGCT
AAGACTCGCTTTATAGCACGTACACTGGTTCTGGTAGGAAGAGCTATGTTGTTTTATGTCCATATTTGACGTGTT
TCAGGTGGTCGTGATCTCCATGGGACAAAGGATAAACCTAAAAATGTGAGAATACCTATGCCCCCTTGTTAAGCA
TACTGATTCAAACATTTCGTTAAGCTTCGTACAGCTCCACAAAGCTCTGACCAAAGTTTTGAGCACTCGGTATGC
AACAATGTACTTTAGTGTATTTCTGCTGCTAACAAGTCATTGATCACTAGTTCAACCAGATGCTGAAGGTGATAT
ATCCTCGAATGAATAACCAGATACACTGGATGCTAAACTACTTTTAAAGGTTTCGTCCGAAACCAGAAACCCAGT
TCGTGTTGTGCGTGGTTTCAAGCTTCAATCTAAATATGCTCCAAGTGAAGGGTTAGTCGAACATCTTGTCTCCCG
ACCTGCAAACTGATCCCAATCCACTTAGATACCGCTACGATGGATTATATGTAGTGGAAAAGGTGGGCGACTCGT
TTTCTTATGACACGTCTTCTGAGAGACTTTAGGCCTTCATGGAGAAAGGAAACAATGCGAAAGGATATCTTGTTT
GCAGATACGTATTTAAGGTTTGTCTCGAAGTGCGTGCGGAAATTGCGTATCTGAGGACCATATTCCAGCGTTTAC
CGGATCAACCCCCTTTGCCAGTTAGAGAGGATTACGAAGACTTGGATTCGGTAGAGGAACCATCGGCGGAAGAAG
ATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail