Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|002480
Gene name
Locationscaffold_01:699533..700763
Strand-
Gene length (bp)1230
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10354 BMT5-like rRNA (uridine-N3-)-methyltransferase BTM5-like 3.5E-50 68 260

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94480|BMT5_SCHPO 25S rRNA (uridine-N(3))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bmt5 PE=3 SV=1 55 256 8.0E-33
sp|P40493|BMT5_YEAST 25S rRNA (uridine(2634)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMT5 PE=1 SV=1 3 271 2.0E-22
sp|P0C8L4|Y4648_ARATH Uncharacterized protein At4g26485 OS=Arabidopsis thaliana GN=At4g26485 PE=4 SV=1 67 200 3.0E-19
sp|Q3UY23|FDXA1_MOUSE Ferredoxin-fold anticodon-binding domain-containing protein 1 homolog OS=Mus musculus GN=Fdxacb1 PE=2 SV=2 67 190 3.0E-12
sp|Q9BRP7|FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens GN=FDXACB1 PE=1 SV=3 67 192 8.0E-12

GO

GO Term Description Terminal node
GO:0070475 rRNA base methylation Yes
GO:0070042 rRNA (uridine-N3-)-methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008170 N-methyltransferase activity No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0003674 molecular_function No
GO:0043414 macromolecule methylation No
GO:0008150 biological_process No
GO:0008649 rRNA methyltransferase activity No
GO:0009451 RNA modification No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0044238 primary metabolic process No
GO:0140102 catalytic activity, acting on a rRNA No
GO:0008168 methyltransferase activity No
GO:0008173 RNA methyltransferase activity No
GO:0046483 heterocycle metabolic process No
GO:0031167 rRNA methylation No
GO:0006364 rRNA processing No
GO:0034470 ncRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0016740 transferase activity No
GO:0044237 cellular metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0032259 methylation No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016436 rRNA (uridine) methyltransferase activity No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0000154 rRNA modification No
GO:0001510 RNA methylation No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0044260 cellular macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3033
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|002480 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|002480
Rhodonia placenta FPRL280 RhoplFPRL280|35_30

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|002480
MGKGLKAALKSQQSRLKEKEKAQKAARAADLKYKKTTTYASSAKSKAREKVLSNQKPTIPFLPSDDILLVGEGNF
SFARALAFHPPSGSGLEDLLPQNITATAYDSEEECYVKYPEAKDIVQNLRERGVEVLFNIDATKLDKISGVKGRK
WDRVVWNFPHAGKGITDQDRNILSNQVLVLDFLRSAAKVLRDGPIPSIHKPKRKPVETADESEDEGVPNPDDMNE
APSNSKARGTVLITLRNVPPYTLWEVPRLAKKPPLPKTGSKFAREHTVLERLAKVARTGLGNFVSVTKPPNNNDC
LDGVDEIWLTWRSPSSLMIW*
Coding >AgabiH39|002480
ATGGGCAAAGGCCTCAAAGCAGCGCTCAAATCTCAGCAATCCAGGCTAAAAGAGAAGGAAAAGGCTCAGAAGGCA
GCTAGGGCTGCAGATCTCAAGTACAAGAAGACCACCACATATGCTTCGTCTGCGAAATCCAAAGCTAGAGAAAAA
GTTCTGTCTAACCAGAAACCCACTATACCTTTCTTACCATCGGATGACATTCTTCTTGTCGGCGAAGGGAACTTT
TCATTTGCGCGCGCATTAGCATTTCACCCACCTTCTGGTTCTGGACTCGAGGACCTGCTACCGCAAAATATTACC
GCTACAGCGTACGATTCGGAAGAAGAATGCTATGTTAAATATCCTGAAGCAAAAGATATCGTTCAGAACCTGCGA
GAACGAGGTGTGGAAGTTCTTTTCAATATCGACGCAACGAAATTGGATAAGATTTCCGGTGTCAAGGGAAGGAAA
TGGGATCGTGTCGTATGGAATTTTCCTCACGCAGGAAAAGGAATCACAGACCAGGACAGGAACATACTTTCTAAT
CAAGTATTGGTCCTGGACTTCCTCCGATCAGCTGCCAAAGTGCTTAGAGATGGACCAATACCTTCAATTCACAAA
CCTAAAAGGAAACCTGTTGAAACTGCCGATGAGAGCGAAGACGAAGGCGTTCCTAACCCCGACGACATGAATGAA
GCACCAAGCAACTCGAAGGCGCGAGGTACCGTCCTCATCACTTTGCGGAACGTCCCACCATACACGCTGTGGGAA
GTACCGAGACTTGCGAAGAAGCCTCCATTGCCAAAGACAGGGAGCAAGTTCGCGAGAGAGCACACGGTGTTGGAA
AGACTGGCGAAGGTGGCGAGGACAGGACTTGGGAATTTTGTCTCCGTGACTAAACCTCCCAATAATAATGATTGC
TTGGATGGTGTAGATGAGATCTGGCTGACTTGGCGTTCACCTAGCTCATTGATGATTTGGTGA
Transcript >AgabiH39|002480
ATGGGCAAAGGCCTCAAAGCAGCGCTCAAATCTCAGCAATCCAGGCTAAAAGAGAAGGAAAAGGCTCAGAAGGCA
GCTAGGGCTGCAGATCTCAAGTACAAGAAGACCACCACATATGCTTCGTCTGCGAAATCCAAAGCTAGAGAAAAA
GTTCTGTCTAACCAGAAACCCACTATACCTTTCTTACCATCGGATGACATTCTTCTTGTCGGCGAAGGGAACTTT
TCATTTGCGCGCGCATTAGCATTTCACCCACCTTCTGGTTCTGGACTCGAGGACCTGCTACCGCAAAATATTACC
GCTACAGCGTACGATTCGGAAGAAGAATGCTATGTTAAATATCCTGAAGCAAAAGATATCGTTCAGAACCTGCGA
GAACGAGGTGTGGAAGTTCTTTTCAATATCGACGCAACGAAATTGGATAAGATTTCCGGTGTCAAGGGAAGGAAA
TGGGATCGTGTCGTATGGAATTTTCCTCACGCAGGAAAAGGAATCACAGACCAGGACAGGAACATACTTTCTAAT
CAAGTATTGGTCCTGGACTTCCTCCGATCAGCTGCCAAAGTGCTTAGAGATGGACCAATACCTTCAATTCACAAA
CCTAAAAGGAAACCTGTTGAAACTGCCGATGAGAGCGAAGACGAAGGCGTTCCTAACCCCGACGACATGAATGAA
GCACCAAGCAACTCGAAGGCGCGAGGTACCGTCCTCATCACTTTGCGGAACGTCCCACCATACACGCTGTGGGAA
GTACCGAGACTTGCGAAGAAGCCTCCATTGCCAAAGACAGGGAGCAAGTTCGCGAGAGAGCACACGGTGTTGGAA
AGACTGGCGAAGGTGGCGAGGACAGGACTTGGGAATTTTGTCTCCGTGACTAAACCTCCCAATAATAATGATTGC
TTGGATGGTGTAGATGAGATCTGGCTGACTTGGCGTTCACCTAGCTCATTGATGATTTGGTGA
Gene >AgabiH39|002480
ATGGGCAAAGGCCTCAAAGCAGCGCTCAAATCTCAGCAATCCAGGCTAAAAGAGAAGGAAAAGGCTCAGAAGGCA
GCTAGGGCTGCAGATCTCAAGTACAAGAAGACCACCACATATGCTTCGTCTGCGAAATCCAAAGCTAGAGAAAAA
GTTCTGTCTAACCAGAAACCCACTATACCTTTCTTACCATCGGATGACATTCTTCTTGTCGGCGAAGGGAACTTT
TCATTTGCGCGCGCATTAGCATTTCACCCACCTTCTGGTTCTGGACTCGAGGACCTGCTACCGCAAAATATTACC
GCTACAGCGTACGATTCGGAAGAAGAATGCTATGTTAAATATCCTGAAGCAAAAGATATCGTTCAGAACCTGCGA
GAACGAGGTGTGGAAGTTCTTTTCAATATCGACGCAACGAAATTGGATAAGATTTCCGGTGTCAAGGGAAGGAAA
TGGGATCGTGTCGTATGGAATTTTCCTCACGCAGGTGCGCACCCACTGTCATTCCATTACCGACAAGTAATTGAG
GATTTCGCGTTCTTGCAGGAAAAGGAATCACAGACCAGGACAGGAACATACTTTCTAATCAAGTATTGGTCCTGG
ACTTCCTCCGATCAGCTGCCAAAGTGCTTAGAGATGGACCAATACCTTCAATTCACAAACCTAAAAGGAAACCTG
TTGAAACTGCCGATGAGAGCGAAGACGAAGGCGTTCCTAACCCCGACGACATGAATGAAGCACCAAGCAACTCGA
AGGCGCGAGGTACCGTCCTCATCACTTTGCGGAACGTCCCACCATACACGCTGTGGTAATCATCTTTTCCCTATT
GCCCAAATTGACACCTTATGTCTGCTGAATATTTCATAGGGAAGTACCGAGACTTGCGAAGAAGCCTCCATTGCC
AAAGACAGGGAGCAAGTTCGTAAACCCGCAGTATATTCAACTTCGTTCCTTCGCGTTCCATCGTAATGCCTGGAG
AAGTTACGAACACCGAATGACTAAAGGCGAGAGAGCACACGGTGTTGGAAAGACTGGCGAAGGTGGCGAGGACAG
GACTTGGGAATTTTGTCTCCGTGACTAAACCTCCCAATAATAATGATTGTATGTCCCTTCTGAGTCGTCCTTCCA
AAATCACTGACTCTCGCTCCTCCCCGATTGGTCACGAAAGGCTTGGATGGTGTAGATGAGATCTGGCTGACTTGG
CGTTCACCTAGCTCATTGATGATTTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail