Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|001820
Gene name
Locationscaffold_01:463792..465066
Strand+
Gene length (bp)1274
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 5.1E-21 101 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 28 272 9.0E-17
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 28 272 9.0E-17
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 32 252 1.0E-13
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 29 300 2.0E-11
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 10 256 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 28 272 9.0E-17
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 28 272 9.0E-17
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 32 252 1.0E-13
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 29 300 2.0E-11
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 10 256 2.0E-10
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 10 256 2.0E-10
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 134 244 3.0E-07
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 134 248 8.0E-07
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 137 244 3.0E-06
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 137 244 5.0E-06
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 134 248 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.999536

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup106
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|000340
Agaricus bisporus var bisporus H39 AgabiH39|001820 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|001830
Agaricus bisporus var bisporus H39 AgabiH39|063250
Agaricus bisporus var bisporus H39 AgabiH39|090410
Agaricus bisporus var bisporus H97 AgabiH97|000340
Agaricus bisporus var bisporus H97 AgabiH97|001820
Agaricus bisporus var bisporus H97 AgabiH97|001830
Agaricus bisporus var bisporus H97 AgabiH97|063250
Agaricus bisporus var bisporus H97 AgabiH97|090410
Rhodonia placenta FPRL280 RhoplFPRL280|214_10
Rhodonia placenta FPRL280 RhoplFPRL280|283_4
Rhodonia placenta FPRL280 RhoplFPRL280|551_2
Rhodonia placenta FPRL280 RhoplFPRL280|551_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|001820
MLAPTLLAVASTLIASVGANPLKLKRQSITALSSEQIDFYTPYTHFAGAAFCESTTLTSWTCGANCEANSDFIPT
AAGGDGDGVQFWYVGYSPSQSSVIVGHQGTNVSNFMAVATDLRVFQMNLDEDFFPGISSSIEVHFGFSTQHAVTA
ESILSAVQTTIRDHNATLVTIVGHSLGCALALLDGVYLPLHIPDVTFRTIGYGCPRVGNQAFADYVDANVNFTRI
NNREDIIPIVPGRFLDYVHPSGEIHISEENDDAWLACPGQDNESDECIVGAVSNIFFGDEDDHAGPYNGIYLGAC
NADGAPVEEN*
Coding >AgabiH39|001820
ATGTTGGCACCCACTCTTCTGGCTGTGGCTTCCACTCTCATTGCTTCCGTGGGTGCCAATCCTTTGAAGCTCAAA
CGACAAAGCATCACAGCCCTCAGCTCGGAGCAAATCGACTTTTATACACCTTACACTCATTTTGCTGGAGCGGCG
TTTTGTGAATCTACCACACTCACTTCATGGACTTGCGGAGCAAACTGCGAAGCTAATTCTGACTTTATCCCAACT
GCGGCGGGTGGCGACGGAGATGGTGTCCAATTTTGGTATGTGGGATATTCACCATCTCAGTCATCGGTCATTGTA
GGGCATCAAGGAACCAATGTCAGTAACTTCATGGCTGTCGCTACGGATTTAAGGGTGTTCCAAATGAACCTCGAT
GAAGACTTCTTCCCTGGTATTTCTTCCTCTATCGAAGTACACTTTGGATTTTCCACGCAACATGCCGTTACTGCA
GAGAGTATTTTATCTGCTGTCCAAACCACGATTCGTGATCATAATGCAACTCTGGTGACAATTGTCGGCCATTCA
CTTGGTTGTGCTCTCGCCCTGCTTGATGGGGTGTATCTTCCCCTCCACATTCCTGACGTCACTTTCCGCACAATT
GGTTATGGCTGTCCCAGAGTTGGCAACCAAGCTTTCGCCGACTATGTCGATGCAAACGTCAATTTCACTCGTATC
AACAACAGAGAGGACATTATCCCTATCGTACCCGGAAGATTCCTAGACTATGTTCACCCATCTGGAGAAATCCAT
ATCTCTGAAGAAAACGATGACGCTTGGCTAGCTTGTCCTGGTCAAGACAATGAAAGCGATGAATGCATTGTTGGT
GCCGTCTCAAACATTTTCTTCGGTGATGAGGATGATCACGCTGGTCCTTATAATGGCATTTATCTTGGAGCATGC
AATGCTGACGGGGCACCAGTTGAGGAAAATTAA
Transcript >AgabiH39|001820
ATGTTGGCACCCACTCTTCTGGCTGTGGCTTCCACTCTCATTGCTTCCGTGGGTGCCAATCCTTTGAAGCTCAAA
CGACAAAGCATCACAGCCCTCAGCTCGGAGCAAATCGACTTTTATACACCTTACACTCATTTTGCTGGAGCGGCG
TTTTGTGAATCTACCACACTCACTTCATGGACTTGCGGAGCAAACTGCGAAGCTAATTCTGACTTTATCCCAACT
GCGGCGGGTGGCGACGGAGATGGTGTCCAATTTTGGTATGTGGGATATTCACCATCTCAGTCATCGGTCATTGTA
GGGCATCAAGGAACCAATGTCAGTAACTTCATGGCTGTCGCTACGGATTTAAGGGTGTTCCAAATGAACCTCGAT
GAAGACTTCTTCCCTGGTATTTCTTCCTCTATCGAAGTACACTTTGGATTTTCCACGCAACATGCCGTTACTGCA
GAGAGTATTTTATCTGCTGTCCAAACCACGATTCGTGATCATAATGCAACTCTGGTGACAATTGTCGGCCATTCA
CTTGGTTGTGCTCTCGCCCTGCTTGATGGGGTGTATCTTCCCCTCCACATTCCTGACGTCACTTTCCGCACAATT
GGTTATGGCTGTCCCAGAGTTGGCAACCAAGCTTTCGCCGACTATGTCGATGCAAACGTCAATTTCACTCGTATC
AACAACAGAGAGGACATTATCCCTATCGTACCCGGAAGATTCCTAGACTATGTTCACCCATCTGGAGAAATCCAT
ATCTCTGAAGAAAACGATGACGCTTGGCTAGCTTGTCCTGGTCAAGACAATGAAAGCGATGAATGCATTGTTGGT
GCCGTCTCAAACATTTTCTTCGGTGATGAGGATGATCACGCTGGTCCTTATAATGGCATTTATCTTGGAGCATGC
AATGCTGACGGGGCACCAGTTGAGGAAAATTAA
Gene >AgabiH39|001820
ATGTTGGCACCCACTCTTCTGGCTGTGGCTTCCACTCTCATTGCTTCCGTGGGTGCCAATCCTTTGAAGCTCAAA
CGACAAAGCATCACAGCCCTCAGCTCGGAGCAAATCGACTTTTATACACCTTACACTCATTTTGCTGGAGCGGCG
TTTTGTGAATCTACCACACTCACTTCATGGACTTGCGGAGGTAGCACATCTTGCATGTTCATTTCTGCGATACTA
ATGTCATTTTTTTTAAATTAGCAAACTGCGAAGCTAATTCTGACTTTATCCCAACTGCGGCGGGTGGCGACGGAG
ATGGTGTCCAATTTTGTGTGTATCCCGTTATTCTTACGCAGTCTGGATCTGGTCATGAACGATTAATCTCAGGGT
ATGTGGGATATTCACCATCTCAGTCATCGGTCATTGTAGGGCATCAAGGAACCAATGTCAGTAACTTGTGAGTGT
GAACATAAAATCATCTTCATCCAGAATCTTACTATCATTGATCTTGATTAGCATGGCTGTCGCTACGGATTTAAG
GGTGTTCCAAATGAACCTCGATGAAGACTTCTTCCCTGGTATTTCTTCCTCTATCGAAGTACACTTTGGATTTTC
CACGCAACATGCCGTGTAAGCTCAAATAATCTTACGGTATTAAATCTGAACTCACGGGATGGAAACAGTACTGCA
GAGAGTATTTTATCTGCTGTCCAAACCACGATTCGTGATCATAATGCAACTCTGGTGACAATTGTCGGCCATTCA
CTTGGTTGTGCTCTCGCCCTGCTTGATGGGGTGTATCTTCCCCTCCACATTCCTGACGTCACTTTCCGCACAATT
GGTTATGGCTGTCCCAGAGTGAGTGACAAAATTCTTTGTTTATGGTCAATCTGAAGGTTGACTCTATATGATACT
TTAGGTTGGCAACCAAGCTTTCGCCGACTATGTCGATGCAAACGTCAATTTCACTCGTATCAACAACAGAGAGGA
CATTATCCCTATCGTACCCGGTGCGTAACCTAGAATGCTTCTTGACTATCTGCCTGAACCAATCGTATCCTTTAG
GAAGATTCCTAGACTATGTTCACCCATCTGGAGAAATCCATATCTCTGAAGAAAACGATGACGCTTGGCTAGCTT
GTCCTGGTCAAGACAATGAAAGCGATGAATGCATTGTTGGTGCCGTCTCAAACATTTTCTTCGGTGATGAGGATG
ATCACGCTGGTCCTTATAATGGCATTTATCTTGGAGCATGCAATGCTGACGGGGCACCAGTTGAGGAAAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail