Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|790450
Gene name
Locationscaffold_13:1273564..1275255
Strand+
Gene length (bp)1691
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-17 5 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 5 392 2.0E-69
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 7 393 2.0E-66
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 5 393 1.0E-61
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 6 393 2.0E-61
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 4 391 8.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 5 392 2.0E-69
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 7 393 2.0E-66
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 5 393 1.0E-61
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 6 393 2.0E-61
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 4 391 8.0E-55
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 12 393 2.0E-52
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 6 392 1.0E-50
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 5 391 1.0E-45
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 8 393 7.0E-41
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 1 372 2.0E-27
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 1 356 2.0E-25
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 14 348 1.0E-23
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 1 367 7.0E-15
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 9 392 2.0E-14
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 8 140 4.0E-11
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 5 243 3.0E-06
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 4 379 6.0E-06
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 6 166 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 29 51 22
3 61 83 22
4 90 112 22
5 192 214 22
6 226 245 19
7 255 277 22
8 284 306 22
9 316 338 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|790450
MSFNIFVWSIALACHAACTNFAGLFVVRLILGACEGSITAGFLIVTSMFYTRNEQTVRVGWWFLMNGTAQIIMGF
ISFGVAHIGTGKFKPWQWLMVITGLMTLLTSISFWLWFPDSPKTAWFLTRDEKVKAIRRIMENQTGVENKSFKKE
QVYEALMDPKTWLFALFSAANNVPNSITNQRSIIVNSFGFTVLQTTLLGIVDGVIEIATIWTGVEICARIPNSRA
YISCIFFIPNILGTFLINFLPWENKIGLLFSQWITGVGTTGFVLALAWVSCVTAGHTKRVTVNAIMLSAYCIGNA
VGPFMWQARYKPRNHVPWIVTGVCYASNIFVMLALRWVMTRENKRRDSEPRDTTYDEVYLERENGDGTIDKIRVD
KEFLDLTDMQNRDFRYVL*
Coding >Agabi119p4|790450
ATGAGTTTCAACATATTCGTTTGGTCTATAGCACTTGCTTGTCATGCTGCCTGCACGAATTTCGCAGGTCTCTTC
GTTGTCAGATTGATCCTTGGGGCATGCGAGGGTTCCATTACCGCCGGTTTTCTGATCGTCACATCCATGTTCTAC
ACGAGGAATGAGCAGACGGTTCGAGTGGGATGGTGGTTTTTGATGAACGGAACAGCTCAAATCATCATGGGTTTC
ATCAGCTTTGGCGTAGCTCACATTGGTACTGGAAAGTTTAAACCTTGGCAATGGTTGATGGTAATTACTGGGTTA
ATGACATTGCTAACGTCGATATCGTTCTGGTTGTGGTTCCCTGACTCTCCAAAAACCGCTTGGTTCCTAACAAGG
GACGAGAAAGTTAAAGCGATCAGGAGAATCATGGAAAACCAAACTGGAGTGGAAAATAAGAGCTTCAAGAAAGAG
CAGGTATACGAGGCGCTTATGGACCCGAAGACATGGCTTTTCGCCCTTTTCTCCGCCGCCAACAACGTTCCCAAC
TCGATCACAAATCAAAGATCCATCATAGTAAACAGTTTTGGCTTCACTGTCCTTCAGACGACCCTTCTAGGGATC
GTGGATGGTGTAATAGAAATCGCTACCATCTGGACTGGAGTTGAAATCTGTGCCCGGATTCCCAACAGTCGCGCC
TACATTAGCTGCATCTTCTTCATACCCAATATACTCGGCACCTTCTTAATCAACTTCTTGCCATGGGAGAACAAA
ATTGGACTCCTTTTCTCTCAATGGATCACTGGCGTGGGCACCACCGGATTTGTGCTTGCATTGGCCTGGGTATCT
TGCGTCACCGCTGGTCATACAAAGAGGGTCACTGTCAACGCTATCATGCTATCAGCCTATTGTATTGGCAATGCT
GTGGGACCTTTCATGTGGCAAGCACGTTATAAACCGAGGAATCACGTTCCTTGGATTGTCACTGGCGTTTGCTAT
GCATCCAACATATTCGTCATGCTAGCTTTGCGCTGGGTGATGACCAGGGAGAACAAGCGCCGTGATAGTGAACCC
CGCGATACGACTTATGATGAAGTATACCTTGAACGCGAAAATGGAGACGGGACTATCGATAAGATACGAGTTGAC
AAGGAATTTTTGGATCTTACGGATATGCAAAACCGCGACTTCCGATACGTCTTGTAA
Transcript >Agabi119p4|790450
ATGAGTTTCAACATATTCGTTTGGTCTATAGCACTTGCTTGTCATGCTGCCTGCACGAATTTCGCAGGTCTCTTC
GTTGTCAGATTGATCCTTGGGGCATGCGAGGGTTCCATTACCGCCGGTTTTCTGATCGTCACATCCATGTTCTAC
ACGAGGAATGAGCAGACGGTTCGAGTGGGATGGTGGTTTTTGATGAACGGAACAGCTCAAATCATCATGGGTTTC
ATCAGCTTTGGCGTAGCTCACATTGGTACTGGAAAGTTTAAACCTTGGCAATGGTTGATGGTAATTACTGGGTTA
ATGACATTGCTAACGTCGATATCGTTCTGGTTGTGGTTCCCTGACTCTCCAAAAACCGCTTGGTTCCTAACAAGG
GACGAGAAAGTTAAAGCGATCAGGAGAATCATGGAAAACCAAACTGGAGTGGAAAATAAGAGCTTCAAGAAAGAG
CAGGTATACGAGGCGCTTATGGACCCGAAGACATGGCTTTTCGCCCTTTTCTCCGCCGCCAACAACGTTCCCAAC
TCGATCACAAATCAAAGATCCATCATAGTAAACAGTTTTGGCTTCACTGTCCTTCAGACGACCCTTCTAGGGATC
GTGGATGGTGTAATAGAAATCGCTACCATCTGGACTGGAGTTGAAATCTGTGCCCGGATTCCCAACAGTCGCGCC
TACATTAGCTGCATCTTCTTCATACCCAATATACTCGGCACCTTCTTAATCAACTTCTTGCCATGGGAGAACAAA
ATTGGACTCCTTTTCTCTCAATGGATCACTGGCGTGGGCACCACCGGATTTGTGCTTGCATTGGCCTGGGTATCT
TGCGTCACCGCTGGTCATACAAAGAGGGTCACTGTCAACGCTATCATGCTATCAGCCTATTGTATTGGCAATGCT
GTGGGACCTTTCATGTGGCAAGCACGTTATAAACCGAGGAATCACGTTCCTTGGATTGTCACTGGCGTTTGCTAT
GCATCCAACATATTCGTCATGCTAGCTTTGCGCTGGGTGATGACCAGGGAGAACAAGCGCCGTGATAGTGAACCC
CGCGATACGACTTATGATGAAGTATACCTTGAACGCGAAAATGGAGACGGGACTATCGATAAGATACGAGTTGAC
AAGGAATTTTTGGATCTTACGGATATGCAAAACCGCGACTTCCGATACGTCTTGTAA
Gene >Agabi119p4|790450
ATGAGGTAATGATAAATGCCCAATTCAATTTAACGCCGCTAATTATACGTTCCTAGTTTCAACATATTCGTTTGG
TCTATAGCACTTGCTTGTCATGCTGCCTGCACGAATTTCGCAGGTCTCTTCGTTGTCAGATTGATCCTTGGGGCA
TGCGAGGGTTCCATTACCGCCGGTTTTCTGATCGTCACATCCATGTTCTACACGAGGAATGAGCAGACGGTTCGA
GTGGGATGGTGGTGTGAGTCAGGTTCACCTTTCGTTGTTTTCTTGCGCTCAATGATTTTTTTCCAGTTTTGATGA
ACGGAACAGGTTTGAGTCTCAATCATTGTGGTAGTGGTGATTTCTAATATAGCTGAACGTTAGCTCAAATCATCA
TGGGTTTCATCAGCTTTGGCGTAGCTCACATTGGTACTGGAAAGTTTAAACCTTGGCAATGGTACTGTGCGCTTG
CCGTCATCGAGTTGAATGCTAAAATCTTTTCAGGTTGATGGTAATTACTGGGTTAATGACATTGCTAACGTCGAT
ATCGTTCTGGTATGTGTTTGTACCCGCCGTTTTTCCCGGCGTCACTAACTGGGCATAGGTTGTGGTTCCCTGACT
CTCCAAAAACCGCTTGGTTCCTAACAAGGGACGAGAAAGTTAAAGCGATCAGGAGAATCATGGTGAGTCCGCAAC
TCTACCTGGTTTTATGATGCTTAATGAAACGACAGGAAAACCAAACTGGAGTGGAAAATAAGAGCTTCAAGAAAG
AGCAGTCTGTAAAGTTTTACTGATGCCTTTTATTTTCACTCATGGGAGTTTTTCAGGGTATACGAGGCGCTTATG
GACCCGAAGACATGGCTTTTCGCCCTTTTCTCCGCCGCCAACAACGTTCCCAACTCGATCACAAATCAAAGATCC
ATCATAGTAAACAGTTTTGGCTTCACTGTCCTTCAGACGACCCTTCTAGGGATCGTGGATGGTGTAATAGAAATC
GCTACCATCTGGACTGGAGTTGAAATCTGTGCCCGGATTCCCAACAGTCGCGCCTACATTAGCTGCATCTTCTTC
ATACCCAATATACTCGGCACCTTCTTAATCAACTTCTTGCCATGGGAGAACAAAATTGGACTCCTTTTCTCTCAA
TGGATCACTGGTATGTAGGAGCCTAAAGCATCGTTACCATCGCTGACTATCAGTTTTTAGGCGTGGGCACCACCG
GATTTGTGCTTGCATTGGCCTGGGTATCTTGCGTCACCGCTGGTCATACAAAGAGGGTCACTGTCAACGCTATCA
TGCTATCAGCCTATTGTATTGGCAATGCTGTGGGACCTTTCATGTGGCAAGCACGTTATAAACCGAGGTGAGGTG
TTCCGTTGAACTGGATGACTTCCCATCCTTATAGACTTGATTAGGAATCACGTTCCTTGGATTGTCACTGGCGTT
TGCTATGCATCCAACATATTCGTCATGCTAGCTTTGCGCTGGGTGATGACCAGGGAGAACAAGCGCCGTGATAGT
GAACCCCGCGATACGACTTATGATGAAGTATACCTTGAACGCGAAAATGGAGACGGGACTATCGATAAGATACGA
GTTGACAAGGTAGGCATAGGAGAACACTTGATGAACCAAAATACTAATCGATTACTTTCCAGGAATTTTTGGATC
TTACGGATATGCAAAACCGCGACTTCCGATACGTCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail