Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|790300
Gene name
Locationscaffold_13:1258518..1267803
Strand+
Gene length (bp)9285
Transcript length (bp)6099
Coding sequence length (bp)6099
Protein length (aa) 2033

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01074 Glyco_hydro_38N Glycosyl hydrolases family 38 N-terminal domain 7.5E-80 1147 1414
PF02171 Piwi Piwi domain 7.3E-76 593 891
PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain 7.4E-50 1619 1829
PF09261 Alpha-mann_mid Alpha mannosidase middle domain 5.6E-26 1420 1517
PF16486 ArgoN N-terminal domain of argonaute 1.1E-19 102 241
PF08699 ArgoL1 Argonaute linker 1 domain 1.3E-14 258 305
PF02170 PAZ PAZ domain 2.8E-13 324 418
PF16488 ArgoL2 Argonaute linker 2 domain 5.7E-12 434 479
PF17677 Glyco_hydro38C2 Glycosyl hydrolases family 38 C-terminal beta sandwich domain 1.3E-04 1892 1995

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22855|MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMS1 PE=1 SV=2 894 1942 0.0E+00
sp|Q9UT61|MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ams1 PE=3 SV=1 895 1996 0.0E+00
sp|Q54K67|MANG_DICDI Alpha-mannosidase G OS=Dictyostelium discoideum GN=manG PE=1 SV=1 899 1997 0.0E+00
sp|Q91W89|MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus GN=Man2c1 PE=1 SV=1 899 2003 7.0E-179
sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1 899 1965 1.0E-174
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22855|MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMS1 PE=1 SV=2 894 1942 0.0E+00
sp|Q9UT61|MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ams1 PE=3 SV=1 895 1996 0.0E+00
sp|Q54K67|MANG_DICDI Alpha-mannosidase G OS=Dictyostelium discoideum GN=manG PE=1 SV=1 899 1997 0.0E+00
sp|Q91W89|MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus GN=Man2c1 PE=1 SV=1 899 2003 7.0E-179
sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1 899 1965 1.0E-174
sp|P21139|MA2C1_RAT Alpha-mannosidase 2C1 OS=Rattus norvegicus GN=Man2c1 PE=1 SV=1 899 2001 3.0E-172
sp|Q7Y001|AGO12_ORYSJ Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2 94 889 2.0E-100
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 89 889 8.0E-96
sp|Q69VD5|PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica GN=PHN1 PE=2 SV=1 94 889 1.0E-95
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 93 889 2.0E-95
sp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D OS=Oryza sativa subsp. japonica GN=AGO1D PE=2 SV=1 94 889 6.0E-94
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 94 895 2.0E-93
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 93 889 3.0E-93
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 93 889 1.0E-92
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 93 889 4.0E-91
sp|Q9UKV8|AGO2_HUMAN Protein argonaute-2 OS=Homo sapiens GN=AGO2 PE=1 SV=3 94 910 5.0E-91
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 94 882 1.0E-90
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 94 910 1.0E-90
sp|Q9QZ81|AGO2_RAT Protein argonaute-2 OS=Rattus norvegicus GN=Ago2 PE=2 SV=2 94 910 1.0E-90
sp|O77503|AGO2_RABIT Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus GN=AGO2 PE=1 SV=2 94 910 1.0E-90
sp|Q6QME8|AGO2_BOVIN Protein argonaute-2 OS=Bos taurus GN=AGO2 PE=2 SV=1 94 910 1.0E-90
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 89 885 4.0E-90
sp|Q6DJB9|AGO2_XENTR Protein argonaute-2 OS=Xenopus tropicalis GN=ago2 PE=2 SV=1 94 910 5.0E-90
sp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C OS=Oryza sativa subsp. japonica GN=AGO1C PE=2 SV=1 93 889 6.0E-90
sp|Q6DCX2|AGO2_XENLA Protein argonaute-2 OS=Xenopus laevis GN=ago2 PE=2 SV=1 94 910 1.0E-89
sp|Q6Z4F1|AGO14_ORYSJ Protein argonaute 14 OS=Oryza sativa subsp. japonica GN=AGO14 PE=2 SV=1 94 889 7.0E-88
sp|A3KPK0|AGO3_DANRE Protein argonaute-3 OS=Danio rerio GN=ago3 PE=3 SV=1 94 910 6.0E-86
sp|Q9H9G7|AGO3_HUMAN Protein argonaute-3 OS=Homo sapiens GN=AGO3 PE=1 SV=2 94 910 1.0E-85
sp|Q8CJG1|AGO1_MOUSE Protein argonaute-1 OS=Mus musculus GN=Ago1 PE=1 SV=2 94 910 1.0E-85
sp|Q9UL18|AGO1_HUMAN Protein argonaute-1 OS=Homo sapiens GN=AGO1 PE=1 SV=3 94 910 1.0E-85
sp|Q8CJF9|AGO3_MOUSE Protein argonaute-3 OS=Mus musculus GN=Ago3 PE=2 SV=2 94 910 2.0E-85
sp|Q9SDG8|AGO4A_ORYSJ Protein argonaute 4A OS=Oryza sativa subsp. japonica GN=AGO4A PE=2 SV=1 79 910 2.0E-84
sp|Q5ZLG4|AGO3_CHICK Protein argonaute-3 OS=Gallus gallus GN=AGO3 PE=2 SV=1 94 910 3.0E-84
sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus GN=AGO3 PE=2 SV=2 94 910 2.0E-82
sp|Q0JF58|AGO4B_ORYSJ Protein argonaute 4B OS=Oryza sativa subsp. japonica GN=AGO4B PE=2 SV=1 94 910 7.0E-81
sp|Q4KLV6|AGO4_XENLA Protein argonaute-4 OS=Xenopus laevis GN=ago4 PE=2 SV=1 94 910 9.0E-80
sp|Q9HCK5|AGO4_HUMAN Protein argonaute-4 OS=Homo sapiens GN=AGO4 PE=1 SV=2 94 910 2.0E-78
sp|Q9ZVD5|AGO4_ARATH Protein argonaute 4 OS=Arabidopsis thaliana GN=AGO4 PE=1 SV=2 94 894 2.0E-77
sp|Q8CJF8|AGO4_MOUSE Protein argonaute-4 OS=Mus musculus GN=Ago4 PE=2 SV=2 94 910 2.0E-77
sp|Q84VQ0|AGO9_ARATH Protein argonaute 9 OS=Arabidopsis thaliana GN=AGO9 PE=1 SV=2 98 885 5.0E-76
sp|Q5ZMW0|AGO4_CHICK Protein argonaute-4 OS=Gallus gallus GN=AGO4 PE=2 SV=1 260 910 1.0E-74
sp|Q7XTS4|AGO2_ORYSJ Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2 199 896 5.0E-71
sp|Q9C793|AGO7_ARATH Protein argonaute 7 OS=Arabidopsis thaliana GN=AGO7 PE=2 SV=1 94 889 7.0E-71
sp|P34681|TAG76_CAEEL Putative protein tag-76 OS=Caenorhabditis elegans GN=tag-76 PE=3 SV=2 365 897 2.0E-69
sp|Q852N2|AGO13_ORYSJ Protein argonaute 13 OS=Oryza sativa subsp. japonica GN=AGO13 PE=2 SV=1 271 895 2.0E-69
sp|Q3E984|AGO8_ARATH Protein argonaute 8 OS=Arabidopsis thaliana GN=AGO8 PE=3 SV=1 98 894 3.0E-69
sp|Q6H6C3|AGO17_ORYSJ Protein argonaute 17 OS=Oryza sativa subsp. japonica GN=AGO17 PE=2 SV=1 91 894 5.0E-69
sp|Q75HC2|AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2 88 889 7.0E-69
sp|Q10F39|AGO11_ORYSJ Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2 91 892 1.0E-68
sp|Q6YSJ5|AGO16_ORYSJ Protein argonaute 16 OS=Oryza sativa subsp. japonica GN=AGO16 PE=2 SV=2 94 894 5.0E-68
sp|Q5NBN9|AGO15_ORYSJ Protein argonaute 15 OS=Oryza sativa subsp. japonica GN=AGO15 PE=2 SV=2 272 894 5.0E-67
sp|Q9SHF3|AGO2_ARATH Protein argonaute 2 OS=Arabidopsis thaliana GN=AGO2 PE=1 SV=1 48 900 6.0E-66
sp|Q7XTS3|AGO3_ORYSJ Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2 103 896 1.0E-64
sp|O48771|AGO6_ARATH Protein argonaute 6 OS=Arabidopsis thaliana GN=AGO6 PE=2 SV=2 281 894 1.0E-59
sp|Q9SHF2|AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana GN=AGO3 PE=3 SV=1 82 889 4.0E-57
sp|Q9VUQ5|AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster GN=AGO2 PE=1 SV=3 98 898 4.0E-53
sp|O61931|ERGO1_CAEEL Piwi-like protein ergo-1 OS=Caenorhabditis elegans GN=ergo-1 PE=1 SV=2 363 896 3.0E-40
sp|Q96J94|PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1 255 882 5.0E-33
sp|Q8UVX0|PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1 453 882 8.0E-32
sp|Q9JMB7|PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1 347 882 2.0E-30
sp|Q7Z3Z4|PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens GN=PIWIL4 PE=2 SV=2 98 882 2.0E-30
sp|A6N7Y9|PIWL1_CHICK Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 255 882 3.0E-30
sp|Q21770|WAGO1_CAEEL Argonaute protein wago-1 OS=Caenorhabditis elegans GN=wago-1 PE=1 SV=1 253 917 3.0E-29
sp|Q4G033|PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus GN=Piwil4 PE=2 SV=2 98 882 9.0E-29
sp|Q8CGT6|PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus GN=Piwil4 PE=1 SV=3 98 882 4.0E-28
sp|O76922|AUB_DROME Protein aubergine OS=Drosophila melanogaster GN=aub PE=1 SV=1 98 882 5.0E-27
sp|Q8CDG1|PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus GN=Piwil2 PE=1 SV=2 589 882 2.0E-26
sp|A2CEI6|PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio GN=piwil2 PE=1 SV=2 591 882 2.0E-26
sp|Q09249|YQ53_CAEEL Uncharacterized protein C16C10.3 OS=Caenorhabditis elegans GN=C16C10.3 PE=3 SV=1 302 889 2.0E-26
sp|Q7Z3Z3|PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens GN=PIWIL3 PE=2 SV=2 255 882 4.0E-26
sp|Q8TC59|PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens GN=PIWIL2 PE=1 SV=1 589 882 5.0E-26
sp|Q7PLK0|AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3 95 882 3.0E-25
sp|A8KBF3|PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis GN=piwil2 PE=1 SV=1 589 882 7.0E-25
sp|A6P7L8|PIWL2_ONCMY Piwi-like protein 2 OS=Oncorhynchus mykiss GN=piwil2 PE=2 SV=1 591 882 2.0E-23
sp|Q9VKM1|PIWI_DROME Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1 98 882 3.0E-22
sp|Q2Q5Y9|PIWI1_SCHMD Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 453 897 3.0E-17
sp|Q21691|NRDE3_CAEEL Nuclear RNAi defective-3 protein OS=Caenorhabditis elegans GN=nrde-3 PE=1 SV=1 327 889 8.0E-16
sp|Q2Q5Y8|PIWI2_SCHMD Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 601 895 6.0E-12
sp|Q2PC95|PIWIL_DUGJA Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1 601 905 4.0E-11
sp|P27046|MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus GN=Man2a1 PE=1 SV=2 1147 1332 2.0E-10
sp|Q55ER0|MANC_DICDI Alpha-mannosidase C OS=Dictyostelium discoideum GN=manC PE=3 SV=1 1141 1286 7.0E-10
sp|Q16706|MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens GN=MAN2A1 PE=1 SV=2 1148 1332 1.0E-09
sp|Q54KN4|MANF_DICDI Alpha-mannosidase F OS=Dictyostelium discoideum GN=manF PE=3 SV=1 1151 1560 4.0E-09
sp|Q9KER1|MNGB_BACHD Putative mannosylglycerate hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mngB PE=3 SV=2 1151 1512 1.0E-08
sp|P28494|MA2A1_RAT Alpha-mannosidase 2 OS=Rattus norvegicus GN=Man2a1 PE=1 SV=2 1147 1332 1.0E-08
sp|P49641|MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens GN=MAN2A2 PE=2 SV=3 1147 1332 2.0E-08
sp|Q8BRK9|MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus GN=Man2a2 PE=1 SV=2 1147 1332 3.0E-08
sp|C6LTG5|AGO_GIAIB Protein argonaute OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) GN=Ago PE=3 SV=1 396 884 2.0E-07
sp|Q9LFR0|GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana GN=GMII PE=1 SV=1 1127 1332 4.0E-07
sp|Q1ZXI8|MANE_DICDI Alpha-mannosidase E OS=Dictyostelium discoideum GN=manE PE=3 SV=1 1148 1518 1.0E-06
sp|Q54YF7|MANB_DICDI Alpha-mannosidase B OS=Dictyostelium discoideum GN=manB PE=3 SV=1 1145 1292 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006013 mannose metabolic process Yes
GO:0004559 alpha-mannosidase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005515 protein binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0019318 hexose metabolic process No
GO:0005488 binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0015923 mannosidase activity No
GO:1901363 heterocyclic compound binding No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0044281 small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|790300
MILPRGLSVGSILQGRGPLDGTYDGRFGGARRASSKPSTRGRVPNVGRPGIPAGIYVPSRRPIAIDARLVDGSQN
RVIEDFKRATNNENDLSVRPDLGIRGREIVLRTNYFAMNIPEGPIYQYEVVTTPPVFTRWMRRRIFELAESTKLW
KEVLAGLAVHDRSAKLVSSTMLPQPLSIDIPFYFEGKNPPVEGSQGHITYNLTIKFDRKLETESLKKFIAGDPRY
RSHDVMPIISALNLILAAWPTRSGGGGVMVGHNKFFMPNTRNSMPLGRGLEAFHGFHSSVRAAHEALMVNIDLCT
TAFYKPGNLAVAFMDHMKAKSCLMTFFKGLQVKTTHLRSRKTIRGTTEYTAKTYAFNHQEFGEISVEEYLLKKYA
IKLQYPRLPLVDLGGPKVNYLPPELCAILPNQPYHGKPLPEHANAVARYTSQAPNGIANVIETQGFKELGFSQNV
PTLKAFGISVSREMATIPGRIISPPKIMYERKLDRKSFNDGTAGWNLKDAKFLKGATLRDWAVLLVNDGSRTEFR
GPSDPRLLATLKDFIQVCCNCGLNVTSSPTISEVRLPPIDQNDPGREKGRNILRNVLPDMYKRKPQLVLTILCNT
DTHIYAELKRLFDLTLDLPNVCVVAEKFTKGGPRYHSNVSLKVNVKLGGINHVLDKASVSWLNEVPTMVVGIDVT
HPGIAAVRDTPSVAAVVASVDRDCVQFPASLRLQEPKKEMVTDLKDMMVERLRAFHSKSNKYPERILIYRDGVSE
GQRETVLKEELPAIIQACKAIDPGYRPQLTIVVCVKNHHTLFFPTDVKDVNEKFYLLPGTVVDQGITSAHHFDFF
LQANGSFRDATRSTYYIVIHDEIGFTSDQLQALTNNISYMYARATQAIGLASPAYYADLACERGAKWSKGLARQR
LDNFLGGHFSDVNLSSVLFTHRLDGPDFVKLKVWSAPGLSKPSFEEAMKQKFRTAKKGDSFGPSFSVTIPEYFKQ
YERVQFEFDPGCEAMIYTVDGVPLQGITGGFGGDRRVEYIIPQEAREQCYHEFVVESSCNGMFGVPWNGDTIQPP
DMNRFFTLASADLVVPNQEAWRLLWDFQTLKELIDTLPGNTPLQNKALVVANEIMNLLKRGDVSSVAACRKKAEE
IFGEGWESKGAEIYEEGPKISNIWGIGHCHIDSAWLWPYSVTQQKVARSWSTQVDLMERYPEHRFTCSSAQQYKW
LEQLYPPLFDRVKEKVLEGKFHTVGGSWVENDSNMPSGEALIRQFLFGQRYFESRFGKRCDTAWLPDSFGLTGSL
PQLIRGSGMKYFFTQKLSWNNINVFPHSTFNWVGIDGTQVLCHMTPVETYTAQATVGDINKGLTNHKNLESNDTA
LLVFGNGDGGGGPLPKMLENLRRIRAVTNTHRELPPVSMGHSVEEFFEDIEESTEAGKDLPNWNGELYLEFHRGT
YTSHGSIKKGNRHSEILLRDLEHVSTLASLYKSEYAYPKGKIDENWEKVLLNQFHDVLPGSAIGMVYNDAEKLYA
EVKASGESLLDEALSVLFPDSLPLGLPKHKYSRSSYSRLIGYNMTFLPRWDIIKIPLQSANSALKAQIMQASDDG
KEGYAVMTSGNGSQVGQVRSPSSALHAKLLPTSVYTNGSDHFVLRNSSVQLTISKGRITSLLDVKLNRELIAEGQ
TGGFVIFEDRPNYWDAWDVEIHHLQTARQLEFSDVTVLTQGPLRASVKAEIRYGQSLVTATISLDAIPATTKANS
RSLFNFETVVDWHQRHEFLKFEVPLDIHNPNATYEMQFGYVQRPTHKNTSWDIAKFEVCGHKYADFSEFGYGVAI
LSESKYGFSCIGNVLRISLLRAATAPDAEQDQGLHQFSFALLPHEGSFYESDVPQAAYLYNSPLRVRVLPNGGDS
VMRSLLESPFTLTGARNVILETVKRGEDDDFNASLTESESGTATVVLRLYEAFGGHGKVQLNISRHLPIAKAFAT
NFLEDEEQELTIDRNSNGNNGDDDLTAPGCSMSLNFRGFEVKTIKLVIGAPPHTPFSPKTKDRRKRDSWVNVDRD
RLLACDL*
Coding >Agabi119p4|790300
ATGATTCTTCCTCGAGGACTCTCTGTGGGGTCTATACTGCAAGGACGCGGACCACTTGATGGAACCTACGACGGT
CGCTTTGGCGGCGCGCGACGTGCCTCATCCAAGCCCTCCACTCGCGGCAGGGTCCCTAACGTTGGACGCCCGGGT
ATTCCAGCAGGAATATATGTCCCATCTCGCCGCCCTATTGCAATCGACGCCAGGCTCGTTGACGGCTCTCAGAAT
CGGGTCATAGAGGATTTCAAGCGCGCCACCAACAATGAAAACGATCTTTCCGTGCGCCCCGATCTTGGCATAAGA
GGACGGGAAATCGTTTTAAGAACGAATTATTTTGCTATGAATATTCCAGAAGGCCCAATCTATCAGTATGAAGTC
GTGACTACCCCTCCCGTTTTTACCAGATGGATGAGAAGGCGCATATTCGAACTCGCGGAAAGCACCAAACTCTGG
AAGGAGGTTCTAGCGGGTTTAGCCGTCCACGATCGTTCTGCCAAGCTTGTGTCATCAACAATGCTACCCCAACCC
TTATCAATCGACATTCCCTTCTATTTTGAGGGCAAAAATCCACCCGTGGAGGGCTCTCAGGGCCACATAACATAC
AATTTGACTATCAAATTTGATAGGAAGCTCGAGACCGAGAGTTTGAAAAAATTTATTGCTGGAGATCCTCGATAT
CGTTCACATGATGTTATGCCTATCATCTCGGCCCTTAATCTCATCCTGGCTGCCTGGCCGACTCGTTCCGGAGGT
GGAGGAGTGATGGTAGGGCACAACAAGTTTTTCATGCCGAACACCCGTAATTCTATGCCTCTCGGACGGGGTTTG
GAAGCATTCCACGGTTTCCACTCATCCGTCCGGGCCGCTCATGAAGCCCTCATGGTCAACATCGATCTTTGTACT
ACTGCATTCTACAAACCTGGAAACCTGGCGGTTGCCTTCATGGATCACATGAAGGCTAAATCTTGTCTCATGACT
TTCTTCAAAGGACTCCAGGTCAAGACTACTCATTTGCGTAGTCGCAAGACCATTCGAGGGACCACTGAATATACT
GCAAAAACCTACGCTTTTAATCATCAAGAGTTTGGTGAAATTTCTGTCGAAGAGTATCTCCTCAAGAAATACGCG
ATCAAGCTGCAATATCCGAGGCTTCCGCTAGTCGACCTGGGGGGCCCCAAAGTGAATTACCTTCCTCCAGAGCTC
TGCGCGATTCTGCCCAATCAGCCATACCACGGAAAGCCCCTTCCTGAGCATGCGAATGCTGTGGCTCGTTACACA
AGCCAAGCGCCCAACGGCATTGCAAATGTCATCGAAACGCAGGGCTTCAAGGAACTCGGATTCTCGCAGAATGTC
CCTACGCTTAAAGCCTTCGGTATCAGTGTCTCACGGGAGATGGCTACTATCCCTGGTCGCATTATTTCTCCACCC
AAAATCATGTATGAAAGAAAGCTCGATCGTAAATCTTTCAATGACGGAACTGCGGGTTGGAATCTCAAGGATGCT
AAATTTTTGAAAGGTGCAACACTACGAGACTGGGCAGTCCTCCTCGTCAATGATGGTAGCCGTACTGAGTTCCGC
GGGCCATCTGATCCAAGATTGCTGGCCACGTTGAAGGATTTTATTCAAGTATGCTGCAACTGTGGGCTTAATGTC
ACGTCGTCACCGACGATTTCGGAGGTTCGCCTTCCCCCTATTGATCAAAACGATCCGGGAAGGGAGAAGGGGAGG
AACATATTACGCAATGTTTTGCCCGATATGTATAAACGGAAACCGCAGCTCGTTCTTACTATCTTATGCAATACC
GATACCCACATTTATGCCGAGTTGAAGCGTCTTTTCGATTTGACACTTGATCTCCCGAACGTTTGTGTCGTAGCA
GAAAAGTTTACGAAAGGCGGACCCCGATACCATTCAAACGTCAGTCTGAAAGTCAACGTGAAGCTTGGCGGTATT
AATCATGTTCTCGATAAAGCTAGCGTCAGCTGGCTTAACGAAGTGCCCACGATGGTAGTCGGCATTGACGTGACT
CATCCTGGTATTGCAGCAGTCAGGGATACCCCTTCAGTTGCTGCCGTTGTTGCTAGTGTTGATCGTGACTGTGTG
CAATTCCCCGCTAGCCTGCGATTGCAAGAGCCGAAGAAGGAGATGGTGACTGACCTCAAGGATATGATGGTTGAG
AGATTGAGAGCCTTCCACTCAAAGAGCAATAAGTACCCGGAACGCATTCTCATATACCGCGATGGTGTCTCTGAG
GGACAACGTGAAACGGTTCTCAAGGAAGAATTACCCGCTATTATACAGGCCTGCAAAGCAATCGATCCGGGGTAC
CGTCCTCAGTTGACTATTGTTGTTTGCGTCAAGAATCACCACACTTTATTTTTTCCTACCGATGTTAAAGACGTT
AATGAAAAGTTTTATCTTTTACCCGGAACAGTGGTTGATCAGGGTATCACCTCGGCTCATCACTTCGACTTCTTC
CTCCAAGCGAACGGAAGTTTTCGCGACGCCACCAGGTCTACGTACTATATCGTCATCCACGACGAAATTGGATTC
ACCTCGGATCAGTTGCAAGCTCTGACGAACAACATCAGTTACATGTATGCTCGTGCTACTCAAGCGATTGGTCTT
GCATCCCCGGCATACTACGCTGACCTTGCGTGCGAGCGCGGAGCAAAATGGAGCAAGGGACTTGCCCGGCAGCGA
CTAGATAACTTTCTTGGCGGCCATTTTTCGGATGTCAACCTTTCCTCTGTCCTTTTCACTCATAGACTCGATGGC
CCGGATTTCGTCAAGCTCAAAGTTTGGAGTGCCCCAGGTCTTTCGAAGCCGTCTTTCGAAGAAGCCATGAAGCAA
AAATTCAGAACGGCGAAGAAAGGCGATTCTTTCGGACCGTCTTTCTCGGTCACCATTCCGGAGTACTTTAAGCAA
TATGAGCGCGTCCAATTCGAATTTGACCCGGGGTGTGAGGCGATGATTTATACAGTCGACGGAGTTCCTCTTCAA
GGCATTACTGGTGGTTTTGGAGGTGACCGTCGCGTTGAATACATTATTCCTCAAGAAGCCAGGGAGCAATGTTAC
CATGAGTTCGTTGTCGAATCTAGCTGCAATGGCATGTTCGGTGTACCTTGGAATGGGGATACTATTCAACCTCCA
GATATGAACCGATTTTTCACTCTCGCCTCTGCCGACCTTGTCGTTCCCAACCAAGAGGCATGGCGTCTGCTCTGG
GATTTCCAAACCCTGAAGGAGCTTATTGATACTCTTCCCGGCAACACACCGTTGCAAAACAAGGCCCTAGTTGTC
GCTAATGAGATAATGAACCTTCTGAAGCGTGGTGATGTCTCCAGCGTTGCTGCTTGTAGAAAGAAAGCCGAAGAA
ATATTCGGAGAAGGATGGGAGTCTAAGGGCGCTGAGATTTATGAAGAAGGCCCTAAAATTTCAAATATCTGGGGT
ATTGGACATTGCCATATCGACTCTGCCTGGCTTTGGCCTTATTCCGTAACTCAACAGAAAGTTGCTCGTTCCTGG
TCAACGCAAGTTGACCTCATGGAACGATATCCCGAACACCGTTTCACATGTAGTTCAGCACAACAATACAAGTGG
CTGGAGCAGCTCTACCCGCCTTTATTTGACCGCGTCAAAGAAAAGGTTCTTGAGGGCAAGTTCCACACAGTTGGA
GGTTCCTGGGTCGAAAACGATTCGAATATGCCTTCCGGTGAGGCACTGATTCGGCAGTTCTTGTTCGGTCAGAGG
TACTTCGAGTCAAGGTTTGGGAAGAGGTGTGATACGGCGTGGCTACCTGATTCCTTTGGATTGACCGGATCTTTA
CCGCAATTAATTCGTGGCTCAGGCATGAAGTATTTCTTTACGCAGAAATTGTCATGGAACAATATAAACGTTTTC
CCTCACTCGACATTCAATTGGGTCGGAATCGATGGTACCCAAGTATTGTGTCATATGACACCAGTTGAGACGTAT
ACTGCTCAAGCAACAGTTGGTGATATCAACAAAGGATTGACAAATCACAAGAACCTTGAGTCGAATGACACTGCA
CTGCTTGTTTTTGGCAATGGTGACGGTGGAGGCGGTCCGCTCCCCAAAATGCTTGAGAATCTACGCCGTATTCGT
GCCGTAACAAATACCCATCGTGAACTTCCCCCTGTTAGTATGGGCCATTCAGTGGAAGAATTTTTTGAAGATATT
GAGGAATCAACGGAAGCAGGCAAAGATTTACCGAACTGGAATGGTGAACTATACCTTGAGTTCCATCGTGGTACA
TATACCTCGCACGGTTCGATCAAGAAGGGCAATCGTCACTCGGAGATATTGCTTCGAGATCTTGAGCATGTTTCC
ACTCTAGCATCTTTATACAAGAGTGAATATGCATATCCCAAAGGGAAGATCGATGAAAATTGGGAAAAAGTCCTC
CTCAATCAATTCCATGATGTCCTTCCTGGATCTGCGATTGGGATGGTATATAATGACGCTGAAAAACTCTATGCC
GAAGTGAAAGCCTCTGGAGAGTCTCTGCTTGACGAAGCTTTATCTGTTCTCTTTCCGGATTCTTTGCCTCTTGGT
CTGCCGAAACACAAATATTCTAGAAGTTCTTACAGCAGGCTCATTGGCTACAATATGACGTTCCTCCCTCGTTGG
GACATAATCAAAATTCCTCTGCAGAGCGCGAATTCGGCTTTGAAGGCACAAATCATGCAAGCTAGCGATGATGGA
AAGGAAGGGTACGCCGTTATGACGAGTGGTAATGGAAGTCAAGTGGGGCAAGTGAGGAGTCCCAGTAGTGCGTTG
CATGCGAAATTATTACCAACTTCTGTGTATACCAATGGCTCCGATCATTTTGTGCTTCGTAACTCGAGTGTCCAG
TTGACCATTTCCAAGGGTCGCATCACGAGTCTCCTCGATGTGAAGCTTAATCGTGAACTTATAGCTGAGGGACAA
ACGGGTGGCTTTGTGATATTCGAAGATCGTCCTAACTATTGGGATGCCTGGGATGTAGAGATCCATCATCTACAG
ACTGCTCGTCAACTCGAGTTCAGCGACGTTACTGTTTTGACGCAAGGACCTCTACGAGCCTCTGTCAAGGCCGAG
ATCCGTTATGGACAAAGCTTGGTAACAGCTACGATCTCGCTTGATGCTATCCCAGCCACGACGAAGGCAAACTCA
CGCTCCTTGTTCAATTTTGAGACAGTGGTTGATTGGCACCAACGTCATGAGTTCCTTAAATTCGAGGTGCCTCTC
GATATTCATAATCCGAACGCCACGTATGAAATGCAATTCGGCTATGTTCAACGACCTACGCACAAAAATACTTCT
TGGGATATCGCCAAGTTCGAAGTCTGTGGTCACAAGTACGCCGATTTTAGCGAGTTTGGTTATGGAGTCGCTATT
CTTTCTGAGTCTAAGTACGGATTTTCATGCATTGGAAACGTGCTCCGCATTTCTCTTCTGAGAGCTGCAACTGCT
CCTGATGCGGAACAAGATCAGGGACTTCACCAATTTTCGTTTGCCCTCCTTCCTCATGAGGGCTCGTTTTACGAG
TCTGATGTCCCTCAAGCTGCGTATCTATACAACTCTCCTTTGCGAGTACGAGTATTACCAAATGGCGGTGACTCG
GTCATGAGATCCCTTTTGGAATCACCATTCACACTCACAGGAGCGCGTAACGTCATACTTGAAACTGTGAAGCGC
GGTGAGGATGACGATTTCAATGCGTCTCTGACGGAATCCGAGTCGGGGACAGCCACGGTCGTCTTGAGATTATAC
GAAGCCTTTGGTGGTCACGGCAAAGTTCAGCTAAACATCTCACGCCACTTGCCGATCGCCAAAGCATTTGCGACC
AACTTTTTGGAGGATGAAGAGCAGGAACTGACCATCGATCGAAACTCAAATGGAAATAATGGCGACGATGATCTT
ACCGCGCCAGGATGTTCCATGAGTTTGAATTTCCGCGGATTTGAGGTTAAGACGATTAAGCTCGTCATTGGTGCG
CCTCCTCATACACCCTTTTCTCCCAAGACGAAAGACCGCAGAAAGAGAGATAGTTGGGTCAATGTAGATCGAGAT
CGCTTATTAGCATGTGATCTGTGA
Transcript >Agabi119p4|790300
ATGATTCTTCCTCGAGGACTCTCTGTGGGGTCTATACTGCAAGGACGCGGACCACTTGATGGAACCTACGACGGT
CGCTTTGGCGGCGCGCGACGTGCCTCATCCAAGCCCTCCACTCGCGGCAGGGTCCCTAACGTTGGACGCCCGGGT
ATTCCAGCAGGAATATATGTCCCATCTCGCCGCCCTATTGCAATCGACGCCAGGCTCGTTGACGGCTCTCAGAAT
CGGGTCATAGAGGATTTCAAGCGCGCCACCAACAATGAAAACGATCTTTCCGTGCGCCCCGATCTTGGCATAAGA
GGACGGGAAATCGTTTTAAGAACGAATTATTTTGCTATGAATATTCCAGAAGGCCCAATCTATCAGTATGAAGTC
GTGACTACCCCTCCCGTTTTTACCAGATGGATGAGAAGGCGCATATTCGAACTCGCGGAAAGCACCAAACTCTGG
AAGGAGGTTCTAGCGGGTTTAGCCGTCCACGATCGTTCTGCCAAGCTTGTGTCATCAACAATGCTACCCCAACCC
TTATCAATCGACATTCCCTTCTATTTTGAGGGCAAAAATCCACCCGTGGAGGGCTCTCAGGGCCACATAACATAC
AATTTGACTATCAAATTTGATAGGAAGCTCGAGACCGAGAGTTTGAAAAAATTTATTGCTGGAGATCCTCGATAT
CGTTCACATGATGTTATGCCTATCATCTCGGCCCTTAATCTCATCCTGGCTGCCTGGCCGACTCGTTCCGGAGGT
GGAGGAGTGATGGTAGGGCACAACAAGTTTTTCATGCCGAACACCCGTAATTCTATGCCTCTCGGACGGGGTTTG
GAAGCATTCCACGGTTTCCACTCATCCGTCCGGGCCGCTCATGAAGCCCTCATGGTCAACATCGATCTTTGTACT
ACTGCATTCTACAAACCTGGAAACCTGGCGGTTGCCTTCATGGATCACATGAAGGCTAAATCTTGTCTCATGACT
TTCTTCAAAGGACTCCAGGTCAAGACTACTCATTTGCGTAGTCGCAAGACCATTCGAGGGACCACTGAATATACT
GCAAAAACCTACGCTTTTAATCATCAAGAGTTTGGTGAAATTTCTGTCGAAGAGTATCTCCTCAAGAAATACGCG
ATCAAGCTGCAATATCCGAGGCTTCCGCTAGTCGACCTGGGGGGCCCCAAAGTGAATTACCTTCCTCCAGAGCTC
TGCGCGATTCTGCCCAATCAGCCATACCACGGAAAGCCCCTTCCTGAGCATGCGAATGCTGTGGCTCGTTACACA
AGCCAAGCGCCCAACGGCATTGCAAATGTCATCGAAACGCAGGGCTTCAAGGAACTCGGATTCTCGCAGAATGTC
CCTACGCTTAAAGCCTTCGGTATCAGTGTCTCACGGGAGATGGCTACTATCCCTGGTCGCATTATTTCTCCACCC
AAAATCATGTATGAAAGAAAGCTCGATCGTAAATCTTTCAATGACGGAACTGCGGGTTGGAATCTCAAGGATGCT
AAATTTTTGAAAGGTGCAACACTACGAGACTGGGCAGTCCTCCTCGTCAATGATGGTAGCCGTACTGAGTTCCGC
GGGCCATCTGATCCAAGATTGCTGGCCACGTTGAAGGATTTTATTCAAGTATGCTGCAACTGTGGGCTTAATGTC
ACGTCGTCACCGACGATTTCGGAGGTTCGCCTTCCCCCTATTGATCAAAACGATCCGGGAAGGGAGAAGGGGAGG
AACATATTACGCAATGTTTTGCCCGATATGTATAAACGGAAACCGCAGCTCGTTCTTACTATCTTATGCAATACC
GATACCCACATTTATGCCGAGTTGAAGCGTCTTTTCGATTTGACACTTGATCTCCCGAACGTTTGTGTCGTAGCA
GAAAAGTTTACGAAAGGCGGACCCCGATACCATTCAAACGTCAGTCTGAAAGTCAACGTGAAGCTTGGCGGTATT
AATCATGTTCTCGATAAAGCTAGCGTCAGCTGGCTTAACGAAGTGCCCACGATGGTAGTCGGCATTGACGTGACT
CATCCTGGTATTGCAGCAGTCAGGGATACCCCTTCAGTTGCTGCCGTTGTTGCTAGTGTTGATCGTGACTGTGTG
CAATTCCCCGCTAGCCTGCGATTGCAAGAGCCGAAGAAGGAGATGGTGACTGACCTCAAGGATATGATGGTTGAG
AGATTGAGAGCCTTCCACTCAAAGAGCAATAAGTACCCGGAACGCATTCTCATATACCGCGATGGTGTCTCTGAG
GGACAACGTGAAACGGTTCTCAAGGAAGAATTACCCGCTATTATACAGGCCTGCAAAGCAATCGATCCGGGGTAC
CGTCCTCAGTTGACTATTGTTGTTTGCGTCAAGAATCACCACACTTTATTTTTTCCTACCGATGTTAAAGACGTT
AATGAAAAGTTTTATCTTTTACCCGGAACAGTGGTTGATCAGGGTATCACCTCGGCTCATCACTTCGACTTCTTC
CTCCAAGCGAACGGAAGTTTTCGCGACGCCACCAGGTCTACGTACTATATCGTCATCCACGACGAAATTGGATTC
ACCTCGGATCAGTTGCAAGCTCTGACGAACAACATCAGTTACATGTATGCTCGTGCTACTCAAGCGATTGGTCTT
GCATCCCCGGCATACTACGCTGACCTTGCGTGCGAGCGCGGAGCAAAATGGAGCAAGGGACTTGCCCGGCAGCGA
CTAGATAACTTTCTTGGCGGCCATTTTTCGGATGTCAACCTTTCCTCTGTCCTTTTCACTCATAGACTCGATGGC
CCGGATTTCGTCAAGCTCAAAGTTTGGAGTGCCCCAGGTCTTTCGAAGCCGTCTTTCGAAGAAGCCATGAAGCAA
AAATTCAGAACGGCGAAGAAAGGCGATTCTTTCGGACCGTCTTTCTCGGTCACCATTCCGGAGTACTTTAAGCAA
TATGAGCGCGTCCAATTCGAATTTGACCCGGGGTGTGAGGCGATGATTTATACAGTCGACGGAGTTCCTCTTCAA
GGCATTACTGGTGGTTTTGGAGGTGACCGTCGCGTTGAATACATTATTCCTCAAGAAGCCAGGGAGCAATGTTAC
CATGAGTTCGTTGTCGAATCTAGCTGCAATGGCATGTTCGGTGTACCTTGGAATGGGGATACTATTCAACCTCCA
GATATGAACCGATTTTTCACTCTCGCCTCTGCCGACCTTGTCGTTCCCAACCAAGAGGCATGGCGTCTGCTCTGG
GATTTCCAAACCCTGAAGGAGCTTATTGATACTCTTCCCGGCAACACACCGTTGCAAAACAAGGCCCTAGTTGTC
GCTAATGAGATAATGAACCTTCTGAAGCGTGGTGATGTCTCCAGCGTTGCTGCTTGTAGAAAGAAAGCCGAAGAA
ATATTCGGAGAAGGATGGGAGTCTAAGGGCGCTGAGATTTATGAAGAAGGCCCTAAAATTTCAAATATCTGGGGT
ATTGGACATTGCCATATCGACTCTGCCTGGCTTTGGCCTTATTCCGTAACTCAACAGAAAGTTGCTCGTTCCTGG
TCAACGCAAGTTGACCTCATGGAACGATATCCCGAACACCGTTTCACATGTAGTTCAGCACAACAATACAAGTGG
CTGGAGCAGCTCTACCCGCCTTTATTTGACCGCGTCAAAGAAAAGGTTCTTGAGGGCAAGTTCCACACAGTTGGA
GGTTCCTGGGTCGAAAACGATTCGAATATGCCTTCCGGTGAGGCACTGATTCGGCAGTTCTTGTTCGGTCAGAGG
TACTTCGAGTCAAGGTTTGGGAAGAGGTGTGATACGGCGTGGCTACCTGATTCCTTTGGATTGACCGGATCTTTA
CCGCAATTAATTCGTGGCTCAGGCATGAAGTATTTCTTTACGCAGAAATTGTCATGGAACAATATAAACGTTTTC
CCTCACTCGACATTCAATTGGGTCGGAATCGATGGTACCCAAGTATTGTGTCATATGACACCAGTTGAGACGTAT
ACTGCTCAAGCAACAGTTGGTGATATCAACAAAGGATTGACAAATCACAAGAACCTTGAGTCGAATGACACTGCA
CTGCTTGTTTTTGGCAATGGTGACGGTGGAGGCGGTCCGCTCCCCAAAATGCTTGAGAATCTACGCCGTATTCGT
GCCGTAACAAATACCCATCGTGAACTTCCCCCTGTTAGTATGGGCCATTCAGTGGAAGAATTTTTTGAAGATATT
GAGGAATCAACGGAAGCAGGCAAAGATTTACCGAACTGGAATGGTGAACTATACCTTGAGTTCCATCGTGGTACA
TATACCTCGCACGGTTCGATCAAGAAGGGCAATCGTCACTCGGAGATATTGCTTCGAGATCTTGAGCATGTTTCC
ACTCTAGCATCTTTATACAAGAGTGAATATGCATATCCCAAAGGGAAGATCGATGAAAATTGGGAAAAAGTCCTC
CTCAATCAATTCCATGATGTCCTTCCTGGATCTGCGATTGGGATGGTATATAATGACGCTGAAAAACTCTATGCC
GAAGTGAAAGCCTCTGGAGAGTCTCTGCTTGACGAAGCTTTATCTGTTCTCTTTCCGGATTCTTTGCCTCTTGGT
CTGCCGAAACACAAATATTCTAGAAGTTCTTACAGCAGGCTCATTGGCTACAATATGACGTTCCTCCCTCGTTGG
GACATAATCAAAATTCCTCTGCAGAGCGCGAATTCGGCTTTGAAGGCACAAATCATGCAAGCTAGCGATGATGGA
AAGGAAGGGTACGCCGTTATGACGAGTGGTAATGGAAGTCAAGTGGGGCAAGTGAGGAGTCCCAGTAGTGCGTTG
CATGCGAAATTATTACCAACTTCTGTGTATACCAATGGCTCCGATCATTTTGTGCTTCGTAACTCGAGTGTCCAG
TTGACCATTTCCAAGGGTCGCATCACGAGTCTCCTCGATGTGAAGCTTAATCGTGAACTTATAGCTGAGGGACAA
ACGGGTGGCTTTGTGATATTCGAAGATCGTCCTAACTATTGGGATGCCTGGGATGTAGAGATCCATCATCTACAG
ACTGCTCGTCAACTCGAGTTCAGCGACGTTACTGTTTTGACGCAAGGACCTCTACGAGCCTCTGTCAAGGCCGAG
ATCCGTTATGGACAAAGCTTGGTAACAGCTACGATCTCGCTTGATGCTATCCCAGCCACGACGAAGGCAAACTCA
CGCTCCTTGTTCAATTTTGAGACAGTGGTTGATTGGCACCAACGTCATGAGTTCCTTAAATTCGAGGTGCCTCTC
GATATTCATAATCCGAACGCCACGTATGAAATGCAATTCGGCTATGTTCAACGACCTACGCACAAAAATACTTCT
TGGGATATCGCCAAGTTCGAAGTCTGTGGTCACAAGTACGCCGATTTTAGCGAGTTTGGTTATGGAGTCGCTATT
CTTTCTGAGTCTAAGTACGGATTTTCATGCATTGGAAACGTGCTCCGCATTTCTCTTCTGAGAGCTGCAACTGCT
CCTGATGCGGAACAAGATCAGGGACTTCACCAATTTTCGTTTGCCCTCCTTCCTCATGAGGGCTCGTTTTACGAG
TCTGATGTCCCTCAAGCTGCGTATCTATACAACTCTCCTTTGCGAGTACGAGTATTACCAAATGGCGGTGACTCG
GTCATGAGATCCCTTTTGGAATCACCATTCACACTCACAGGAGCGCGTAACGTCATACTTGAAACTGTGAAGCGC
GGTGAGGATGACGATTTCAATGCGTCTCTGACGGAATCCGAGTCGGGGACAGCCACGGTCGTCTTGAGATTATAC
GAAGCCTTTGGTGGTCACGGCAAAGTTCAGCTAAACATCTCACGCCACTTGCCGATCGCCAAAGCATTTGCGACC
AACTTTTTGGAGGATGAAGAGCAGGAACTGACCATCGATCGAAACTCAAATGGAAATAATGGCGACGATGATCTT
ACCGCGCCAGGATGTTCCATGAGTTTGAATTTCCGCGGATTTGAGGTTAAGACGATTAAGCTCGTCATTGGTGCG
CCTCCTCATACACCCTTTTCTCCCAAGACGAAAGACCGCAGAAAGAGAGATAGTTGGGTCAATGTAGATCGAGAT
CGCTTATTAGCATGTGATCTGTGA
Gene >Agabi119p4|790300
ATGATTCTTCCTCGAGGACTCTCTGTGGGGTCTATACTGCAAGGACGCGGACCACTTGATGGAACCTACGACGGT
CGCTTTGGCGGCGCGCGACGTGCCTCATCCAAGCCCTCCACTCGCGGCAGGGTCCCTAACGTTGGACGCCCGGGT
ATTCCAGCAGGGTACATCATTTCATCTTTTGCATTAGCCCCTTTGTTGATACCTCGAAATATTTGACAGAATATA
TGTCCCATCTCGCCGCCCTATTGCAATCGACGCCAGGCTCGTTGACGGCTCTCAGAATCGGGTCATAGAGGATTT
CAAGCGCGCCACCAACAATGAAAACGATCTTTCCGTGCGCCCCGATCTTGGCATAAGAGGACGGGAAATCGTTTT
AAGAACGAATTATTTTGCTATGAATATTCCAGAAGGCCCAATCTATCAGTATGAAGTCGTGACTACCCCTCCCGT
TTTTACCAGATGGATGAGAAGGCGCATATTCGAACTCGCGGAAAGCACCAAACTCTGGAAGGAGGTTCTAGCGGG
TTTAGCCGTCCACGATCGTTCTGCCAAGCTTGTGTCATCAACAATGCTACCCCAACCCTTATCAATCGACATTCC
CTTCTATTTTGAGGGCAAAAATCCACCCGTGGAGGGCTCTCAGGGCCACATAACATACAATTTGACTATCAAATT
TGATAGGAAGCTCGAGACCGAGAGTTTGAAAAAGTCAGTAGTGTGCTGAAAGTTACCTGTATCAGCATCATACAT
AGCTGATCATAGCTTTCATCAGATTTATTGCTGGAGATCCTCGATATCGTTCACATGATGTTATGCCTATCATCT
CGGCCCTTAATCTCATCCTGGCTGCCTGGCCGACTCGTTCCGGAGGTGGAGGAGTGATGGTAGGGCACAACAAGT
TTTTCATGCCGAACACCCGTAATTCTATGCCTCTCGGACGGGGTTTGGAAGCATTCCACGGTTTCCACTCATCCG
TCCGGGCCGCTCATGAAGCCCTCATGGTCAACATCGATCGTGCGTATCTACATTATATGAAGAAATGACTCATAA
TGCCCTTCAATAGTTTGTACTACTGCATTCTACAAACCTGGAAACCTGGCGGTTGCCTTCATGGATCACATGAAG
GCTAAATCTTGTCTCATGACTTTCTTCAAAGGACTCCAGGTCAAGACTACTCATTTGCGTAGTCGCAAGACCATT
CGAGGGACCACTGAATATACTGCAAAAACCTACGCTTTTAATCATCAAGAGTTTGGTGAAATTTCTGTCGAAGAG
TATCTCCTCAAGAGTATGTTTATATGGTACTGTCGTCTAGACGGTCAATGACTAATGTCCTGTGCTAGAATACGC
GATCAAGCTGCAATATCCGAGGCTTCCGCTAGTCGACCTGGGGGGCCCCAAAGTGAATTACCTTCCTCCAGAGCT
CTGCGCGATTCTGCCCAATCAGCCATACCACGGAAAGCCCCTTCCTGAGCATGCGAATGCTGTGGCTCGTTACAC
AAGCCAAGCGCCCAACGGCATTGCAAATGTCATCGAAACGCAGGGCTTCAAGGAACTCGGATTCTCGCAGAATGT
CCCTACGCTTAAAGCCTTCGGTATCAGTGTCTCACGGGAGATGGCTACTATCCCTGGTCGCATTATTTCTCCACC
CAAAATCATGTATGAAAGAAAGCTCGATCGTAAATCTTTCAATGACGGAACTGCGGGTTGGAATCTCAAGGATGC
TAAATTTTTGAAAGGTGCAACACTACGAGACTGGGCAGTCCTCCTCGTCAATGATGGTAGCCGTACTGAGTTCCG
CGGGCCATCTGATCCAAGATTGCTGGCCACGTTGAAGGATTTTATTCAAGTATGCTGCAACTGTGGGCTTAATGT
CACGTCGTCACCGACGATTTCGGAGGTTCGCCTTCCCCCTATTGATCAAAACGATCCGGGAAGGGAGAAGGGGAG
GAACATATTACGCAATGTTTTGCCCGATATGTATAAACGGAAACCGCAGCTCGTTCTTACTATCTTATGCAATAC
CGATACCCACATTTATGCCGAGTTGAAGCGTCTTTTCGATTTGACACTTGATCTCCGTGAGTTGTCTTCGGGTCC
CTCAAACGTCTTTATGCTCTAATTCGATCGAAGCGAACGTTTGTGTCGTAGCAGAAAAGTTTACGAAAGGTGAGG
AAACAAATTTTGGGTTTCCAAATGGCCTTCTTATCTTGTCATAGGCGGACCCCGATACCATTCAAACGTCAGTCT
GAAAGTCAACGTGAAGCTTGGCGGTATTAAGTGAGTTTCAGTCGATACACCCTCTCCAGACTATTCTCATTGTCT
TTCCAGTCATGTTCTCGATAAAGCTAGCGTCAGCTGGCTTAACGAAGTGCCCACGATGGTAGTCGGCATTGACGT
GACTCATCCTGGTATTGCAGCAGTCAGGGATACCCCTTCAGTTGCTGCCGTTGTTGCTAGTGTTGATCGTGACTG
TGTGCAATTCCCCGCTAGCCTGCGATTGCAAGAGCCGAAGAAGGAGGTATGTAATATTATTCGCGCATCTTTGCA
CTTTCTGAGATTTTATAGATGGTGACTGACCTCAAGGATATGATGGTTGAGAGATTGAGAGCCTTCCACTCAAAG
AGCAATAAGTACCCGGAACGCATTCTCATATACCGCGATGGTGTCTCTGAGGCGAGTTAGATCAGTTTTGACGCG
AATAGTTTTCACTCAATTCGTGTTTCCAGGGACAACGTGAAACGGTTCTCAAGGAAGAATTACCCGCTATTATAC
AGGCCTGCAAAGCAATCGATCCGGGGTACCGTCCTCAGTTGACTATTGTTGTTTGCGTATGATTCTTGTTTCTGT
AATCTCTTATGTATGAATCATTGATCTTTTTATAGGTCAAGAATCACCACACTTTATTTTTTCCTACCGATGTTA
AAGACGTTAATGAAAAGTTTTATCTTTTACCCGGAACAGTGGTTGATCAGGGTATCACCTCGGCTCATCACTTCG
ACTTCTTCCTCCAAGGTATTCATCTTCAGCGTTTAGCTTTTTAAAGTGTGCTGATAATAAGACGATATTTAGCGA
ACGGAAGTTTTCGCGACGCCACCAGGTCTACGTACTATATCGTCATCCACGACGAAATTGGATTCACCTCGGATC
AGTTGCAAGCTCTGACGAACAACATCAGTTACATGTATGCTCGTGCTACTCAAGCGATTGGTCTTGCATCCCCGG
CATACTACGCTGACCTTGCGTGCGAGCGCGGTCGGTGCTATTTACACGATATGATGAATAATACTCGAAGCGATT
CAGCTGGTGGAGGAACGGTTTGGGAACACGCGGCTAAGCATTGGGGGAGTGGACCTACAGGCAAGGCCGTGAAGG
ATACTATGTTTTATTTGTGACCTTCGTTTCCGGATGTTTCTTATATTGCTATCCGCATATGTGTGATACCCTGCG
CCCTCTAATTTAATCATTTTTTTTCTTGTCGTCTTCACTTTTGCACTTTGTGTGTGACTGGGCATCGTGTATTGG
TTCACACCATTAACATTCATAAAAGACTGATCGATACTGTTATTTAGCCTTGTCATTCACTCGGACCTCCATCAT
TACAATGTCTTAAGGCTCGAAAGTTATTGTATCAGTTGATGAATTATCGTGGTCTGACTCATTTGGTTGTTGTCT
TTGTACCTTCCACTATTTCTGTGATCTCCAGGCTATACAAGTCGGCTGCAGGGACTCAAGATGTTCATATGGGGA
GATGTGAAAAACTTGGATGAAACGCGTTGTTGGAATGTCATAATGCTAGCGACTCGATTCCATCTGTCGGAACGA
CTTCTTTTCAGACGGAACAATACGATATATTGACTCAGTCATCTAGCCGAGGGGTGAAATTCATTCCGGAAACTG
CAAGCCCCATTTTGCAGGTAAGCTCCTGATTAATTGCACCGGAGATTTAGAGGTGGAACAATTTGGGGTACCATA
ACAGAGGCCACTACCTAGAAGTAGTAGGAATTGGCTTGATTTTGCATCGTCCGGTTCCTGAGGGGCTCCGCCTCT
GCATCACTGTTCAGAGATTACCGGAGCCTTCGGCCGGAGATCGGAGCGGTGCCGCAAAAGGGAATTCCCGGGGAT
TGCGTATTGCGTGTTGCTATCCACACATTCGTCCTCAACAATGAACTGCGACCACCATCCTTCAAGCAGCTCATA
TGCTGAACTCAATCACGGTGCAGGAGCAAAATGGAGCAAGGGACTTGCCCGGCAGCGACTAGATAACTTTCTTGG
CGGCCATTTTTCGGATGTCAACCTTTCCTCTGTCCTTTTCACTCATAGACTCGATGGCCCGGATTTCGTCAAGCT
CAAAGTGTGAGTTGCATGATATGGTGCATCATTCTGCTATATTGAGGTGTCATCTCTTCAGTTGGAGTGCCCCAG
GTCTTTCGAAGCCGTCTTTCGAAGAAGCCATGAAGCAAAAATTCAGAACGGCGAAGAAAGTAAGTAGTTGTAATC
TTCATACATACCCGAGTACTAAGTCATGGCAGGGCGATTCTTTCGGACCGTCTTGTAAGTCGCCATGTATTCTTT
GGGTTTACATTGCTAACATGGCTCCTCTGTAGGGGTAAGCCTCTGCCGCGCGTCCTGTTCAGGGTCATTTCCAAT
ACTTAACTGATTATAGACCAATCACTGGTGGAAAGTCTCGGTCACCATTCCGGAGTACTTTAAGCAATATGAGCG
CGTCCAATGTGAGCATCTTATCCTCTTGATTTCGAACCTCGTCTAATTCTGCGAAAGTCGAATTTGACCCGGGGT
GTGAGGCGATGATTTATACAGTCGACGGAGTTCCTCTTCAAGGTACGAACTTTGATCCGGCTTAGTGGGCATACC
TGAGCCATAATTACAGGCATTACTGGTGGTTTTGGAGGTGACCGTCGCGTTGAATACATTATTCCTCAAGAAGCC
AGGGAGCAATGTTACCATGAGTTCGTTGTCGAATCTAGCTGCAATGGCATGTTCGGTGTACCTTGGAATGGGGAT
ACTATTCAACCTCCAGATGTGAGTGCACTATTCAGACAATCGTTTTTGTCGCTTACGTGTCGTCAAGATGAACCG
ATTTTTCACTCTCGCCTCTGCCGACCTTGTCGTTCCCAACCAAGAGGCATGGCGTCTGCTCTGGGATTTCCAAAC
CCTGAAGGAGCTTATTGATACTCTTCCCGGCAACACACCGTAAGTGAAAGTTGGTTTCATCGTGGCAACGCCTTT
GACTGGAGGACAGGTTGCAAAACAAGGCCCTAGTTGTCGCTAATGAGATAATGAACCTTCTGAAGCGTGGTGATG
TCTCCAGCGTTGCTGCTTGTAGAAAGAAAGCCGAAGAAATATTCGGAGAAGGATGGGAGTCTAAGGGCGCTGAGA
TTTATGAAGAAGGCCCTAAAATTTCAAATATCTGGGGTATTGGACAGTAAGCGTCTATCATTTGTGATACAATGG
CCGGCTTACATTCCTGCACAGTTGCCATATCGACTCTGCCTGGCTTTGGCCTTATTCCGTAACTCAACAGAAAGT
TGCTCGTTCCTGGTCAACGCAAGTTGACCTCATGGAACGATATCCCGAACACCGTTTCACATGTAGTTCAGCACA
ACAATACAAGTGGCTGGAGCAGCTCTACCCGCCTTTATTTGACCGCGTCAAAGAAAAGGTTCTTGAGGGCAAGTT
CCACACAGTTGGAGGTTCCTGGGTCGAAAACGATTCGAATATGCCTTCCGGTGAGGCACTGATTCGGCAGTTCTT
GTTCGGTCAGAGGTACTTCGAGTCAAGGTTTGGGAAGAGGTGTGATACGGCGTGGCTACCTGATTCCTTTGGATT
GACCGGATCTTTACCGCAATTAATTCGTGGCTCAGGTGCGTTTTGTCTAGCTTGTTACGTCACCTTTCTCAACTA
GTGACCATGAACTAGGCATGAAGTATTTCTTTACGCAGAAATTGTCATGGTAAGCTCATTACATATTTACGTCCC
GATTTTGGCTGACAGCACTTATTTTAGGAACAATATGTAGGCCTGAACAGACTGGGTATTCTGCTCCCAATGATT
AACCGAACCCACCTCAGAAACGTTTTCCCTCACTCGACATTCAATTGGGTCGGAATCGATGGTACCCAAGTATTG
TGTCATATGACACCAGGTACTTGTTTCCGTCCCCCTCACCCTCCTACCTTTGATGCTGAGAAACCCTCCATCAGT
TGAGACGTATACTGCTCAAGCAACAGTTGGTGATATCAACAAAGGATTGACAAATCACAAGGTGAGTTTTCTTTT
TCGTGCCTTCGACGTTGATTCTGATGGTTGTTTTTAAGAACCTTGAGTCGAATGACACTGCACTGCTTGTTTTTG
GCAATGGTGACGGTGGAGGCGGTCCGCTCCCCAAAATGCTTGAGAATGTGCGTACATTTATTGAACCAGAAAGGG
TATGAATGGCATCTGATTATACGCTAGCTACGCCGTATTCGTGCCGTAACAAATACCCATCGTGAACTTCCCCCT
GTTAGTATGGGCCATTCAGTGGAAGAATTTTTTGAAGATATTGAGGAATCAACGGAAGCAGGCAAAGATTTACCG
AACTGGTGGGTTTTATCATCTGATTCTGGCTTTTAAATGCTGATCTGAATGCTGATCTGTCGAACAGGAATGGTG
AACTATACCTTGAGGTACGGCGCTTCGCTATAATGTAGGCTCTGGCGGCTGACGTGATACTGGTAGTTCCATCGT
GGTACATATACCTCGCACGGTACGTTGCCTTATCCCTCTTCCTTGATCTGTCGCTTAAAGGCATCAAAGGTTCGA
TCAAGAAGGGCAATCGTCACTCGGAGATATTGCTTCGAGATCTTGAGCATGTTTCCACTCTAGCATCTTTATACA
AGAGTGAATATGCATATCCCAAAGGGAAGATCGATGAAAATTGGGAAAAAGTCCTCCTCAATCAATGTATGCTAT
TTTCGCCCAAACAGTTCTCGTTCTGATGCAGATTCAAACAGTCCATGATGTCCTTCCTGGATCTGCGATGTGAGC
ACTTACTCGATCCAAGCTGCGCTTGTTTTCATCTCGACAATTAGTGGGATGGTATATAATGACGCTGAAAAACTC
TATGCCGAAGTGAAAGCCTCTGGAGAGTCTCTGCTTGACGAAGCTTTATCTGTTCTCTTTCCGGATTCTTTGCCT
CTTGGTCTGCCGAAACACAAATATTCTAGAAGTTCTTACAGCAGGCTCATTGGCTACAATATGACGTTCCTCCCT
CGTTGGGACATAATCAAAATTCCTCTGCAGAGCGCGAATTCGGCTTTGAAGGCACAAATCATGCAAGCTAGCGAT
GATGGAAAGGAAGGGTACGCCGTTATGACGAGTGGTAATGGAAGTCAAGTGGGGCAAGTGAGGAGTCCCAGTAGT
GCGTTGCATGCGAAATTATTACCAACTTCTGGTGCGTCTCTCCATTTCTTTGCGACTTGACTTTTGATAGAAAGG
CACACAGTGTATACCAATGGCTCCGATCATTTTGTGCTTCGTAACTCGAGTGTCCAGTTGACCATTTCCAAGGGT
CGCATCACGAGTCTCCTCGATGTGAAGCTTAAGTGAGATCCTCCCTCTGGGGTTGTTCGCCGCAAATATTTGCTC
ACCAGTTATCTAGTCGTGAACTTATAGCTGAGGGACAAACGGGTGGCTTTGTGATATTCGAAGATCGTCCTAACT
ATTGGGATGCCTGGGGTATGTTCTAACCCTACTTACTTTCCATTTATCTTTCACTAACTCGTGTCCGTTTTAGAT
GTAGAGATCCATCATCTACAGACTGCTCGTCAACTCGAGTTCAGCGACGTTACTGTTTTGACGCAAGGACCTCTA
CGAGCCTCTGTCAAGGCCGAGATCCGTTATGGACAAAGCTTGGTAACAGCTACGGTTAGTAGTTCCGCATCTGAA
GTAGGGAAAGAGTTGATATGATATTGTGTCCAGATCTCGCTTGATGCTATCCCAGCCACGACGAAGGCAAACTCA
CGCTCCTTGTTCAATTTTGAGACAGTGGTTGATTGGCACCAACGTCATGAGTTCCTTAAATGTAGGCCCCCTTGA
GATTTGATTACGACTTTTGCTAATGATTCGCTTTTTGCGGATAGTCGAGGTGCCTCTCGATATTCATAATCCGAA
CGCCACGTATGAAATGCAATTCGGCTATGTTCAACGACCTACGCACAAAAATACTTCTTGGGATATCGCCAAGGT
AGGATCATCCTGTGATTCAGGGGACTTTCGTTGACAGCTTTTTTCATTACCCCCAGTTCGAAGTCTGTGGTCACA
AGGTGAGCTGGAACTATTTTCGCGTCGCCCCAGTTTCACTCACTTTATGTTTTCTCTAGTACGCCGATTTTAGCG
AGTTTGGTTATGGAGTCGCTATTCTTTCTGAGTCTAAGTACGGATTTTCATGCATTGGAAACGTGCTCCGCATTT
CTCTTCTGAGAGCTGCAACTGCTCCTGATGCGGAACAAGATCAGGGTGGGTATTCGCCTGCACCTTGTCTCGTGA
CTTTCTAATATTAGCACAGGACTTCACCAATTTTCGTTTGCCCTCCTTCCTCATGAGGGCTCGTTTTACGAGTCT
GATGTCCCTCAAGCTGCGTATCTATACAACTCTCCTTTGCGAGGTACGTTTTTATGCGTCACACGAAGGGTTTTG
TCTGACTAGAATTATCAGTACGAGTATTACCAAATGGCGGTGACTCGGTCATGAGATCCCTTTTGGAATCACCAT
TCACACTCACAGGAGCGCGTAACGTCATACTTGAAACTGTGAAGCGCGGTGAGGATGACGATTTCAATGCGTCTC
TGACGGAATCCGAGTCGGGGACAGCCACGGTCGTCTTGAGATTATACGAAGCCTTTGGTGGTCACGGCAAAGTTC
AGCTAAACATCTCACGCCACTTGCCGATCGCCAAAGCATTTGCGACCAACTTTTTGGAGGATGAAGAGCAGGAAC
TGACCATCGATCGAAACTCAAATGGAAATAATGGCGACGATGATCTTACCGCGCCAGGATGTTCCATGAGTTTGA
ATTTCCGCGGATTTGAGGTTAAGACGATTAAGCTCGTCATTGGTGCGCCTCCTCATACACCCTTTTCTCCCAAGA
CGAAAGAGTCAGTTTCTTCTACAGCTCTCTGATGCGCCGTGTTAGCTTACACGGATCCCACTGTTTTCCAGCCGC
AGAAAGAGAGATAGTTGGGTCAATGTAGATCGAGATCGCTTATTAGCATGTGATCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail