Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|789700
Gene name
Locationscaffold_13:1196915..1200565
Strand-
Gene length (bp)3650
Transcript length (bp)3366
Coding sequence length (bp)3366
Protein length (aa) 1122

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.2E-09 396 429
PF00320 GATA GATA zinc finger 7.0E-15 496 529
PF08550 DUF1752 Fungal protein of unknown function (DUF1752) 1.4E-10 31 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 395 546 6.0E-30
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 395 545 2.0E-24
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 395 638 2.0E-23
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 395 583 3.0E-23
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 395 589 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 395 546 6.0E-30
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 395 545 2.0E-24
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 395 638 2.0E-23
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 395 583 3.0E-23
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 395 589 4.0E-23
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 391 588 7.0E-23
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 387 545 1.0E-22
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 387 545 1.0E-22
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 395 638 1.0E-22
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 395 545 1.0E-22
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 395 656 2.0E-22
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 386 545 3.0E-22
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 395 567 3.0E-22
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 391 588 3.0E-22
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 395 567 5.0E-22
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 395 545 5.0E-22
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 395 581 6.0E-22
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 395 545 6.0E-22
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 395 545 6.0E-22
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 395 545 7.0E-22
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 395 552 2.0E-21
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 395 555 2.0E-21
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 395 543 4.0E-21
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 395 545 4.0E-21
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 395 584 1.0E-20
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 385 561 3.0E-20
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 396 540 6.0E-20
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 395 545 2.0E-19
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 395 545 3.0E-19
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 395 545 3.0E-19
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 395 545 3.0E-19
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 395 545 3.0E-19
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 395 545 4.0E-19
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 369 545 5.0E-19
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 395 545 7.0E-19
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 395 545 9.0E-19
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 395 545 1.0E-18
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 369 545 2.0E-18
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 395 606 6.0E-18
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 395 656 3.0E-17
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 496 550 4.0E-17
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 495 543 1.0E-16
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 447 584 2.0E-16
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 496 584 3.0E-16
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 496 545 4.0E-16
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 395 551 6.0E-16
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 496 545 1.0E-15
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 395 553 1.0E-15
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 395 561 1.0E-15
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 485 545 1.0E-15
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 448 548 2.0E-15
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 495 553 3.0E-15
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 496 577 3.0E-15
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 496 548 5.0E-15
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 490 545 6.0E-15
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 496 548 7.0E-15
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 496 548 8.0E-15
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 487 541 1.0E-14
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 496 545 1.0E-14
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 496 545 2.0E-14
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 496 545 2.0E-14
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 453 545 8.0E-14
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 496 545 6.0E-11
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 495 572 1.0E-10
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 491 572 4.0E-10
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 506 570 4.0E-10
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 491 572 5.0E-10
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 491 572 5.0E-10
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 491 572 6.0E-10
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 491 572 6.0E-10
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 496 545 7.0E-10
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 496 545 7.0E-10
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 496 545 8.0E-10
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 459 544 1.0E-09
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 492 544 1.0E-09
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 491 572 2.0E-09
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 476 572 2.0E-09
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 495 572 2.0E-09
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 492 544 2.0E-09
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 492 544 2.0E-09
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 491 572 3.0E-09
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 495 572 3.0E-09
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 476 572 3.0E-09
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 495 572 3.0E-09
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 470 572 6.0E-09
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 471 550 6.0E-09
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 471 550 8.0E-09
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 396 436 9.0E-09
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 471 550 1.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 471 550 1.0E-08
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 470 533 1.0E-08
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 396 436 1.0E-08
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 482 533 3.0E-08
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 482 533 3.0E-08
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 491 550 3.0E-08
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 464 533 3.0E-08
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 396 436 3.0E-08
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 396 436 3.0E-08
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 483 533 4.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 495 533 4.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 491 533 5.0E-08
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 478 533 6.0E-08
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 392 437 6.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 392 437 6.0E-08
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 491 533 7.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 392 436 7.0E-08
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 392 437 7.0E-08
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 392 437 7.0E-08
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 396 450 9.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 491 533 1.0E-07
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 491 533 1.0E-07
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 491 533 1.0E-07
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 392 436 1.0E-07
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 477 572 1.0E-07
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 396 436 3.0E-07
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 388 436 6.0E-07
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 380 436 8.0E-07
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 387 436 1.0E-06
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 387 436 2.0E-06
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 387 436 2.0E-06
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 347 436 3.0E-06
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 347 436 3.0E-06
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 390 436 3.0E-06
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 474 533 4.0E-06
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 396 436 4.0E-06
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 379 437 5.0E-06
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 378 441 6.0E-06
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 378 441 6.0E-06
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 378 441 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|789700
MPAILNLKFKGNKSFVAFSNLNDSEALTKTWKVCTKVASFLEQGQRLENLSWRLWHLQNLMVDTDNAKSKREFKK
LSKCMGDKLDKEKGRSIEELEAPDYKRTPSSEMIRQRAAEKERYREQNAKPGTIKRMQFTFSVDQPSAPGANLPV
KKPDLKPSPEFTKRTRAATRAQADDSTLASSSSAISDDLPSLKFDSIFNQGFGPSALLFPAPTLTTRLSYGEGLN
PSNDDTFTVSRPTIELPLDEILNTVDSPPPMPPPPAPPAPAPAPPQQQQDVVMRSVPSKRRTRKSSVATRDDGDS
DHDTTADTTPFASALKSYTPLSQAVKEPETVAPSKLNPLFSTSVTRTNPNTRPTLTVKTQTSARSSGPGATATSL
NPSTLRSSNSSGAPGGVKAECSNCGATHTPLWRRGLNDELNCNACGLYCKLHKRPRPKSMRNSHGGSGSGGSNNN
TGNAAVERPLTVSNASIVQSVTHGIGGGSNSRQDPVDVLGSQTAQCYNCNTTATPLWRKDDEGKTVCNACGLYYK
LHGSPRPISMKSDVIRKRSRHDARRGSNAASSAPGNINNTNTNTTSIEDTQSASPTASRRTSPIHDHDHDPPSPI
LAPDSSTTMSGPNSSSAVNVNVNAATTTLGYDYTQDGLTDAFGTTQSELVGALGQDQTSLFQNTFQFQYPGPYHP
DYLLQMYTAHMHGVGGGVTTSGGAGTGNAGASPDLGNVDLSSPSSSNSVGGQHQQQQHGMQQQHHHTTSPDDLDL
PLMSPRLTKRRRMSIDSCIEEPPVSAVSWYSPESSSISLNGGGTGGTSSSSSGFPFGNTFATVTTTTTTGSGGQK
EQGLGLIGISQHHHSQQGQGQHHHHSLSQPEASTSSHLLLHSSSSSNSSSSSSGSSSSSSPLHHQQQQQQQQQQQ
QQQHSHSHSLSLSHLSPHLSHLQNSQSSHSSSSPHSTHSHHHHHSMSLSHSLSNSHTHTHTHTGGPALRGSGNTF
WHPPMMPLSDEQFHEQFQQQQQQCQSQQSQQSQSQSQQNQQNQQHRILSRSSPYLSSSSSGSKSSLSPSSDMDME
MEIEIEEDSPMDYIHGSTSGTKGLGSGTTGTGSVSGTGTTTTVIQDDESLFSAYLNHHPATPDEGGGEVVV*
Coding >Agabi119p4|789700
ATGCCCGCCATCCTCAATCTCAAGTTCAAGGGGAACAAGTCTTTCGTCGCCTTTTCCAACCTCAACGATTCCGAG
GCCCTCACAAAGACCTGGAAGGTCTGCACAAAGGTCGCCAGCTTCCTCGAACAGGGCCAGCGCCTTGAAAACCTG
AGTTGGCGCCTATGGCACCTCCAGAACCTCATGGTCGACACTGACAACGCAAAGTCCAAACGCGAGTTCAAAAAG
CTCTCCAAATGTATGGGCGACAAGCTCGACAAGGAAAAAGGCCGGAGTATCGAAGAACTCGAGGCACCCGACTAC
AAGCGAACTCCGTCCTCTGAAATGATCCGTCAGCGCGCCGCCGAAAAGGAGCGTTACCGCGAGCAAAATGCAAAG
CCGGGTACAATCAAGCGTATGCAGTTCACGTTTAGCGTCGACCAGCCCTCTGCTCCCGGCGCTAATCTACCCGTC
AAGAAGCCTGATCTCAAACCCTCGCCCGAGTTTACCAAGCGCACTCGCGCCGCAACCCGTGCTCAGGCAGATGAC
TCGACCCTGGCTTCGTCCTCTTCTGCCATCTCTGATGACCTCCCCTCCCTCAAGTTTGATTCCATTTTCAATCAG
GGTTTCGGCCCGTCTGCTTTGCTGTTCCCCGCTCCCACTCTTACTACCCGTCTCAGCTACGGTGAAGGGCTCAAC
CCCTCCAATGACGACACGTTTACCGTTTCGCGTCCAACCATCGAGCTCCCCCTCGATGAAATCCTCAACACTGTC
GATTCTCCTCCCCCCATGCCACCACCACCAGCACCACCAGCACCAGCACCAGCACCACCACAACAACAACAAGAC
GTCGTCATGCGCTCCGTCCCCTCAAAGCGAAGAACACGCAAATCGTCCGTTGCTACCCGCGACGACGGCGATAGC
GACCACGACACTACCGCTGATACCACTCCCTTTGCTTCAGCCCTGAAATCCTACACTCCTCTATCGCAGGCGGTA
AAGGAACCCGAAACAGTCGCTCCATCCAAATTGAACCCTCTCTTCTCTACTTCTGTCACTCGTACAAACCCAAAC
ACCCGTCCAACACTCACTGTCAAAACTCAAACATCAGCCCGTTCTTCCGGCCCGGGAGCCACCGCCACATCACTC
AATCCCTCTACGCTTCGTAGTAGCAATAGCAGTGGCGCCCCTGGAGGCGTCAAAGCCGAATGTTCCAATTGTGGT
GCTACACATACACCTTTGTGGCGAAGAGGGTTGAACGACGAGTTGAATTGTAATGCCTGTGGTTTGTATTGTAAA
TTGCACAAGAGACCGAGACCGAAGAGTATGAGGAATAGTCATGGTGGGAGTGGTAGTGGGGGGAGTAATAATAAT
ACTGGGAATGCGGCTGTGGAGAGACCTTTGACGGTGTCGAATGCGAGTATTGTGCAGAGTGTGACGCATGGGATT
GGGGGTGGAAGCAATAGCAGACAGGATCCTGTGGATGTTTTGGGTTCGCAAACGGCACAATGTTATAATTGTAAT
ACGACTGCTACTCCGCTTTGGAGAAAGGATGATGAAGGAAAGACGGTGTGCAATGCGTGCGGTTTGTATTATAAA
CTTCATGGTTCGCCACGGCCTATTTCGATGAAATCGGATGTTATACGAAAACGGTCTCGACATGATGCTCGGCGT
GGTTCCAATGCTGCTTCCTCTGCTCCTGGAAACATAAACAACACCAACACCAACACCACATCCATCGAAGATACA
CAATCAGCAAGTCCAACTGCCAGTCGTCGAACATCACCTATCCATGATCACGATCATGATCCTCCCTCTCCTATA
TTAGCACCTGATTCATCTACGACTATGTCAGGACCGAATTCGAGTTCGGCAGTGAATGTGAATGTGAATGCTGCG
ACGACGACTTTGGGGTATGATTATACGCAGGATGGGTTGACGGATGCGTTTGGGACGACTCAGTCGGAGTTGGTG
GGTGCGTTGGGACAGGATCAGACGTCGTTGTTTCAGAATACTTTTCAGTTTCAGTATCCGGGGCCTTATCATCCG
GATTATTTGTTGCAGATGTATACGGCGCATATGCATGGTGTAGGTGGTGGTGTGACCACTAGTGGGGGTGCGGGT
ACGGGGAATGCGGGTGCGAGTCCGGATTTGGGGAATGTGGATTTGAGTTCGCCTTCGAGTTCGAATTCGGTTGGA
GGACAACATCAGCAGCAGCAGCATGGTATGCAACAGCAACATCATCATACGACGAGTCCGGATGATTTGGATTTA
CCGTTGATGAGTCCGAGATTGACGAAGAGGAGGAGGATGAGTATTGATTCGTGTATTGAAGAACCACCTGTTTCG
GCTGTGTCGTGGTATTCACCGGAATCAAGTTCGATTTCGCTTAATGGTGGTGGTACTGGGGGGACGTCGTCTTCG
TCGTCGGGGTTTCCGTTTGGGAATACGTTTGCTACTGTTACGACGACGACGACGACAGGGAGTGGGGGGCAGAAG
GAACAGGGGTTGGGGTTGATTGGGATTTCGCAGCATCATCATTCGCAACAAGGGCAGGGACAGCATCATCATCAT
TCGTTATCGCAACCTGAAGCTTCGACTTCGTCGCATCTTTTACTTCATTCTTCAAGTTCATCGAATTCTTCTTCA
TCTAGTTCTGGTTCGAGTTCTTCTTCGTCTCCACTTCATCATCAACAGCAGCAACAGCAACAGCAGCAACAGCAA
CAACAACAACATTCACATTCGCATTCACTTTCACTTTCGCATCTTTCACCCCATCTTTCACATTTGCAAAATTCA
CAATCTTCACATTCTTCTTCTTCTCCGCATTCGACTCATTCTCATCATCATCATCATTCAATGTCACTTTCGCAT
TCACTTTCGAATTCGCATACGCATACGCATACGCATACGGGTGGACCTGCGTTGAGAGGGTCTGGGAATACGTTT
TGGCATCCGCCTATGATGCCTTTGAGTGATGAACAGTTTCATGAACAGTTTCAACAACAACAACAACAGTGTCAA
TCGCAACAATCACAACAATCACAATCACAATCACAGCAGAATCAACAGAATCAACAACATAGGATTTTGAGTAGG
TCTTCACCGTATTTGAGTTCGTCTTCGTCTGGTTCGAAATCGTCGTTGTCGCCATCGTCAGATATGGATATGGAG
ATGGAGATTGAGATTGAGGAGGATAGTCCTATGGATTATATTCATGGTTCTACGAGTGGGACGAAAGGGTTAGGG
AGTGGGACGACAGGGACGGGGAGTGTGAGTGGGACAGGGACGACGACGACGGTGATACAAGATGATGAGAGTTTG
TTTTCGGCTTATTTGAATCATCATCCTGCGACGCCGGATGAGGGAGGAGGGGAAGTTGTTGTTTAA
Transcript >Agabi119p4|789700
ATGCCCGCCATCCTCAATCTCAAGTTCAAGGGGAACAAGTCTTTCGTCGCCTTTTCCAACCTCAACGATTCCGAG
GCCCTCACAAAGACCTGGAAGGTCTGCACAAAGGTCGCCAGCTTCCTCGAACAGGGCCAGCGCCTTGAAAACCTG
AGTTGGCGCCTATGGCACCTCCAGAACCTCATGGTCGACACTGACAACGCAAAGTCCAAACGCGAGTTCAAAAAG
CTCTCCAAATGTATGGGCGACAAGCTCGACAAGGAAAAAGGCCGGAGTATCGAAGAACTCGAGGCACCCGACTAC
AAGCGAACTCCGTCCTCTGAAATGATCCGTCAGCGCGCCGCCGAAAAGGAGCGTTACCGCGAGCAAAATGCAAAG
CCGGGTACAATCAAGCGTATGCAGTTCACGTTTAGCGTCGACCAGCCCTCTGCTCCCGGCGCTAATCTACCCGTC
AAGAAGCCTGATCTCAAACCCTCGCCCGAGTTTACCAAGCGCACTCGCGCCGCAACCCGTGCTCAGGCAGATGAC
TCGACCCTGGCTTCGTCCTCTTCTGCCATCTCTGATGACCTCCCCTCCCTCAAGTTTGATTCCATTTTCAATCAG
GGTTTCGGCCCGTCTGCTTTGCTGTTCCCCGCTCCCACTCTTACTACCCGTCTCAGCTACGGTGAAGGGCTCAAC
CCCTCCAATGACGACACGTTTACCGTTTCGCGTCCAACCATCGAGCTCCCCCTCGATGAAATCCTCAACACTGTC
GATTCTCCTCCCCCCATGCCACCACCACCAGCACCACCAGCACCAGCACCAGCACCACCACAACAACAACAAGAC
GTCGTCATGCGCTCCGTCCCCTCAAAGCGAAGAACACGCAAATCGTCCGTTGCTACCCGCGACGACGGCGATAGC
GACCACGACACTACCGCTGATACCACTCCCTTTGCTTCAGCCCTGAAATCCTACACTCCTCTATCGCAGGCGGTA
AAGGAACCCGAAACAGTCGCTCCATCCAAATTGAACCCTCTCTTCTCTACTTCTGTCACTCGTACAAACCCAAAC
ACCCGTCCAACACTCACTGTCAAAACTCAAACATCAGCCCGTTCTTCCGGCCCGGGAGCCACCGCCACATCACTC
AATCCCTCTACGCTTCGTAGTAGCAATAGCAGTGGCGCCCCTGGAGGCGTCAAAGCCGAATGTTCCAATTGTGGT
GCTACACATACACCTTTGTGGCGAAGAGGGTTGAACGACGAGTTGAATTGTAATGCCTGTGGTTTGTATTGTAAA
TTGCACAAGAGACCGAGACCGAAGAGTATGAGGAATAGTCATGGTGGGAGTGGTAGTGGGGGGAGTAATAATAAT
ACTGGGAATGCGGCTGTGGAGAGACCTTTGACGGTGTCGAATGCGAGTATTGTGCAGAGTGTGACGCATGGGATT
GGGGGTGGAAGCAATAGCAGACAGGATCCTGTGGATGTTTTGGGTTCGCAAACGGCACAATGTTATAATTGTAAT
ACGACTGCTACTCCGCTTTGGAGAAAGGATGATGAAGGAAAGACGGTGTGCAATGCGTGCGGTTTGTATTATAAA
CTTCATGGTTCGCCACGGCCTATTTCGATGAAATCGGATGTTATACGAAAACGGTCTCGACATGATGCTCGGCGT
GGTTCCAATGCTGCTTCCTCTGCTCCTGGAAACATAAACAACACCAACACCAACACCACATCCATCGAAGATACA
CAATCAGCAAGTCCAACTGCCAGTCGTCGAACATCACCTATCCATGATCACGATCATGATCCTCCCTCTCCTATA
TTAGCACCTGATTCATCTACGACTATGTCAGGACCGAATTCGAGTTCGGCAGTGAATGTGAATGTGAATGCTGCG
ACGACGACTTTGGGGTATGATTATACGCAGGATGGGTTGACGGATGCGTTTGGGACGACTCAGTCGGAGTTGGTG
GGTGCGTTGGGACAGGATCAGACGTCGTTGTTTCAGAATACTTTTCAGTTTCAGTATCCGGGGCCTTATCATCCG
GATTATTTGTTGCAGATGTATACGGCGCATATGCATGGTGTAGGTGGTGGTGTGACCACTAGTGGGGGTGCGGGT
ACGGGGAATGCGGGTGCGAGTCCGGATTTGGGGAATGTGGATTTGAGTTCGCCTTCGAGTTCGAATTCGGTTGGA
GGACAACATCAGCAGCAGCAGCATGGTATGCAACAGCAACATCATCATACGACGAGTCCGGATGATTTGGATTTA
CCGTTGATGAGTCCGAGATTGACGAAGAGGAGGAGGATGAGTATTGATTCGTGTATTGAAGAACCACCTGTTTCG
GCTGTGTCGTGGTATTCACCGGAATCAAGTTCGATTTCGCTTAATGGTGGTGGTACTGGGGGGACGTCGTCTTCG
TCGTCGGGGTTTCCGTTTGGGAATACGTTTGCTACTGTTACGACGACGACGACGACAGGGAGTGGGGGGCAGAAG
GAACAGGGGTTGGGGTTGATTGGGATTTCGCAGCATCATCATTCGCAACAAGGGCAGGGACAGCATCATCATCAT
TCGTTATCGCAACCTGAAGCTTCGACTTCGTCGCATCTTTTACTTCATTCTTCAAGTTCATCGAATTCTTCTTCA
TCTAGTTCTGGTTCGAGTTCTTCTTCGTCTCCACTTCATCATCAACAGCAGCAACAGCAACAGCAGCAACAGCAA
CAACAACAACATTCACATTCGCATTCACTTTCACTTTCGCATCTTTCACCCCATCTTTCACATTTGCAAAATTCA
CAATCTTCACATTCTTCTTCTTCTCCGCATTCGACTCATTCTCATCATCATCATCATTCAATGTCACTTTCGCAT
TCACTTTCGAATTCGCATACGCATACGCATACGCATACGGGTGGACCTGCGTTGAGAGGGTCTGGGAATACGTTT
TGGCATCCGCCTATGATGCCTTTGAGTGATGAACAGTTTCATGAACAGTTTCAACAACAACAACAACAGTGTCAA
TCGCAACAATCACAACAATCACAATCACAATCACAGCAGAATCAACAGAATCAACAACATAGGATTTTGAGTAGG
TCTTCACCGTATTTGAGTTCGTCTTCGTCTGGTTCGAAATCGTCGTTGTCGCCATCGTCAGATATGGATATGGAG
ATGGAGATTGAGATTGAGGAGGATAGTCCTATGGATTATATTCATGGTTCTACGAGTGGGACGAAAGGGTTAGGG
AGTGGGACGACAGGGACGGGGAGTGTGAGTGGGACAGGGACGACGACGACGGTGATACAAGATGATGAGAGTTTG
TTTTCGGCTTATTTGAATCATCATCCTGCGACGCCGGATGAGGGAGGAGGGGAAGTTGTTGTTTAA
Gene >Agabi119p4|789700
ATGCCCGCCATCCTCAATCTCAAGTTCAAGGTGTGTTCTTAGCCTTCAACTTTCACTTTCACACTCACTTTCTTA
GGGGAACAAGTCTTTCGTCGCCTTTTCCAACCTCAACGATTCCGAGGCCCTCACAAAGACCTGGAAGGTCCGTCC
GCTCCTCTCTTTTCTCGTCCTTTTCGTCCTCAACTCTCCCCTCCAGGTCTGCACAAAGGTCGCCAGCTTCCTCGA
ACAGGGCCAGCGCCTTGAAAACCTGAGTTGGCGCCTATGGCACCTCCAGAACCTCATGGTCGACACTGACAACGC
AAAGTCCAAACGCGAGTTCAAAAAGCTCTCCAAATGTATGGGCGACAAGCTCGACAAGGAAAAAGGCCGGTACGT
TCTTCCTTTTTTTTTTTCCAACTTGACTCCCTCACCTTATCTTATCTCTCTCTCGCTCAGGAGTATCGAAGAACT
CGAGGCACCCGACTACAAGCGAACTCCGTCCTCTGAAATGATCCGTCAGCGCGCCGCCGAAAAGGAGCGTTACCG
CGAGCAAAATGCAAAGCCGGGTACAATCAAGCGTATGCAGTTCACGTTTAGCGTCGACCAGCCCTCTGCTCCCGG
CGCTAATCTACCCGTCAAGAAGCCTGATCTCAAACCCTCGCCCGAGTTTACCAAGCGCACTCGCGCCGCAACCCG
TGCTCAGGCAGATGACTCGACCCTGGCTTCGTCCTCTTCTGCCATCTCTGATGACCTCCCCTCCCTCAAGTTTGA
TTCCATTTTCAATCAGGGTTTCGGCCCGTCTGCTTTGCTGTTCCCCGCTCCCACTCTTACTACCCGTCTCAGCTA
CGGTGAAGGGCTCAACCCCTCCAATGACGACACGTTTACCGTTTCGCGTCCAACCATCGAGCTCCCCCTCGATGA
AATCCTCAACACTGTCGATTCTCCTCCCCCCATGCCACCACCACCAGCACCACCAGCACCAGCACCAGCACCACC
ACAACAACAACAAGACGTCGTCATGCGCTCCGTCCCCTCAAAGCGAAGAACACGCAAATCGTCCGTTGCTACCCG
CGACGACGGCGATAGCGACCACGACACTACCGCTGATACCACTCCCTTTGCTTCAGCCCTGAAATCCTACACTCC
TCTATCGCAGGCGGTAAAGGAACCCGAAACAGTCGCTCCATCCAAATTGAACCCTCTCTTCTCTACTTCTGTCAC
TCGTACAAACCCAAACACCCGTCCAACACTCACTGTCAAAACTCAAACATCAGCCCGTTCTTCCGGCCCGGGAGC
CACCGCCACATCACTCAATCCCTCTACGCTTCGTAGTAGCAATAGCAGTGGCGCCCCTGGAGGCGTCAAAGCCGA
ATGTTCCAATTGTGGTGCTACACATACACCTTTGTGGCGAAGAGGGTTGAACGACGAGTTGAATTGTAATGCCTG
TGGTTTGTATTGTAAATTGCACAAGAGACCGAGACCGAAGAGTATGAGGAATAGTCATGGTGGGAGTGGTAGTGG
GGGGAGTAATAATAATACTGGGAATGCGGCTGTGGAGAGACCTTTGACGGTGTCGAATGCGAGTATTGTGCAGAG
TGTGACGCATGGGATTGGGGGTGGAAGCAATAGCAGACAGGATCCTGTGGATGTTTTGGGTGAGTTTTTATGCGC
TAAAACCTCTTTTTTTTTTTTACTGAGAAAGGGGCTTTAGGTTCGCAAACGGCACAATGTTATAATTGTAATACG
ACTGCTACTCCGCTTTGGAGAAAGGATGATGAAGGAAAGACGGTGTGCAATGCGTGAGTTTTTTTGTCTTCCCAA
AAACGACTTTGTTTTCCCATTTTGACACTATTTTTATTAGGTGCGGTTTGTATTATAAACTTCATGGTTCGCCAC
GGCCTATTTCGATGAAATCGGATGTTATACGAAAACGGTCTCGACATGATGCTCGGCGTGGTTCCAATGCTGCTT
CCTCTGCTCCTGGAAACATAAACAACACCAACACCAACACCACATCCATCGAAGATACACAATCAGCAAGTCCAA
CTGCCAGTCGTCGAACATCACCTATCCATGATCACGATCATGATCCTCCCTCTCCTATATTAGCACCTGATTCAT
CTACGACTATGTCAGGACCGAATTCGAGTTCGGCAGTGAATGTGAATGTGAATGCTGCGACGACGACTTTGGGGT
ATGATTATACGCAGGATGGGTTGACGGATGCGTTTGGGACGACTCAGTCGGAGTTGGTGGGTGCGTTGGGACAGG
ATCAGACGTCGTTGTTTCAGAATACTTTTCAGTTTCAGTATCCGGGGCCTTATCATCCGGATTATTTGTTGCAGA
TGTATACGGCGCATATGCATGGTGTAGGTGGTGGTGTGACCACTAGTGGGGGTGCGGGTACGGGGAATGCGGGTG
CGAGTCCGGATTTGGGGAATGTGGATTTGAGTTCGCCTTCGAGTTCGAATTCGGTTGGAGGACAACATCAGCAGC
AGCAGCATGGTATGCAACAGCAACATCATCATACGACGAGTCCGGATGATTTGGATTTACCGTTGATGAGTCCGA
GATTGACGAAGAGGAGGAGGATGAGTATTGATTCGTGTATTGAAGAACCACCTGTTTCGGCTGTGTCGTGGTATT
CACCGGAATCAAGTTCGATTTCGCTTAATGGTGGTGGTACTGGGGGGACGTCGTCTTCGTCGTCGGGGTTTCCGT
TTGGGAATACGTTTGCTACTGTTACGACGACGACGACGACAGGGAGTGGGGGGCAGAAGGAACAGGGGTTGGGGT
TGATTGGGATTTCGCAGCATCATCATTCGCAACAAGGGCAGGGACAGCATCATCATCATTCGTTATCGCAACCTG
AAGCTTCGACTTCGTCGCATCTTTTACTTCATTCTTCAAGTTCATCGAATTCTTCTTCATCTAGTTCTGGTTCGA
GTTCTTCTTCGTCTCCACTTCATCATCAACAGCAGCAACAGCAACAGCAGCAACAGCAACAACAACAACATTCAC
ATTCGCATTCACTTTCACTTTCGCATCTTTCACCCCATCTTTCACATTTGCAAAATTCACAATCTTCACATTCTT
CTTCTTCTCCGCATTCGACTCATTCTCATCATCATCATCATTCAATGTCACTTTCGCATTCACTTTCGAATTCGC
ATACGCATACGCATACGCATACGGGTGGACCTGCGTTGAGAGGGTCTGGGAATACGTTTTGGCATCCGCCTATGA
TGCCTTTGAGTGATGAACAGTTTCATGAACAGTTTCAACAACAACAACAACAGTGTCAATCGCAACAATCACAAC
AATCACAATCACAATCACAGCAGAATCAACAGAATCAACAACATAGGATTTTGAGTAGGTCTTCACCGTATTTGA
GTTCGTCTTCGTCTGGTTCGAAATCGTCGTTGTCGCCATCGTCAGATATGGATATGGAGATGGAGATTGAGATTG
AGGAGGATAGTCCTATGGATTATATTCATGGTTCTACGAGTGGGACGAAAGGGTTAGGGAGTGGGACGACAGGGA
CGGGGAGTGTGAGTGGGACAGGGACGACGACGACGGTGATACAAGATGATGAGAGTTTGTTTTCGGCTTATTTGA
ATCATCATCCTGCGACGCCGGATGAGGGAGGAGGGGAAGTTGTTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail