Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|784500
Gene name
Locationscaffold_13:602148..611964
Strand-
Gene length (bp)9816
Transcript length (bp)6516
Coding sequence length (bp)6516
Protein length (aa) 2172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15979 Glyco_hydro_115 Glycosyl hydrolase family 115 1.0E-137 806 1154
PF17829 GH115_C Gylcosyl hydrolase family 115 C-terminal domain 1.1E-54 425 604
PF17829 GH115_C Gylcosyl hydrolase family 115 C-terminal domain 1.3E-56 1432 1609

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 1809 1831 22
2 1838 1860 22
3 1870 1892 22
4 2074 2096 22
5 2116 2135 19
6 2148 2170 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|784500
MDNTSQPSTPVRAESFYFDDDPMAIFLVDNQLFKVHRHFFIEEAEGMSDDKPILLPNVTVKEFKTLLRYFYAMKS
PTSNKKLLADVFAFEQDEKLALLSVAHQFCFDQIYEYILGEIEPGTFSVVDRVRLGDKYGLKDWLSSAYETILER
TPDQKLSREEVDALGLDRTVRILEAKNFVLHKVHDQCLEKSNVPICTKRNLFLERCDCCTRWMDFESAGGSAAIR
KIQNSPAEELFEHDWDFENDYHTLLDGKWDHMMDQTHLGYYYWQQPMTNSMNAINRVQKRKQALAGYMRISVESS
NGAWPGDNPNQCAQGYNCPPPTVALDSYSVFSNRYIDIGAGGPASFSFKISSNTSWVDISPSSGDVSPQNPEKRV
FLSVKDWSSLSDGANTAQLKVTANSKGQPSMTVTIDFSATKAGSIGDFHGFVEGDGVVSMEAAHATRNTTVDGIS
WKNFPGLGRTLSGVTPWPRSDQAFDVGTGPILEYDFFTFNTIAGSGNITVTALLSPSNNAQGQDNPLTVAVALDS
EEPIVHQPMPDSAAGKQPAAWDGVNGFAANNIIPVETKFTNISAGKHTFKIMMTQPAIVVQKIVIDVGGLKPSYL
GPPESHRSCYIRKSFRMVRLLLLAGLYALLNEALAIGQETCVAFRASNSRFPVVTKNQAAPVLVSPDDWPGVQRA
ASDFVTDIQQVTGAKVSLINATTTTNPGKQAPIIVGTLGKSSLIDAIVNSTGLDVSNIQGRWEAFLSREVQNPLP
GISSAYVIIGADKRGTIYALYEHSEQFGVSPWHWWADVPTTRHSELFVDSIGCSHGSPTVKYRGIFLNDEQPALQ
NWAAEKFTNGTGAPNTGSPFNSQFYTKMFELILRLKGNYLWPAIWSSAFAFDDPQSQFLADMYGIVMGTSHQEPM
MRSTPVEFSIEYPNVAWDYVANNDTIKKYWLEGVQRAKDFESVYTMGMRGFGDLPLSEETNIDLLDQVIQDQTDI
LHQVFGQDFDVSTIPQIWALYKEVEGYYEDGLQVPDYVTLLWSDDNWGNIRRYPVESERNRTGGAGVYYHLDYVG
DPRDYKWIATSQIEKIYEQMSIAVEREATRLWIINVGDMKPYEREIEFLLGYGWNATRWSPENVNDFVSAWAQRE
FDVDEKTAVQVSDIVANLTRFNARRKPELLTATTYSLTDYREAENIFAAWEDLEKSSTTVYNSLDEDFKPSFYQL
VHYPVLASSNLGKLYILAGQNNLRASQARLSTNVLADTAVELFEHDFDLETDYHQLLDGKWDHMMQQTRIGYYYW
QQPMADSMPPVTRVQAKKQALAGAMRIVPEGTQGAWPGDNPHQCADGFNCPPPSVSLDNFSPISNRYVDVGAGGP
APFTFTASSNATWVKLSATKGSISPKAPEQRVYISVADWSQLQDGMNTAQIRFTAKASGQPDLSVSVFLNALKNN
VASGFKGFVEGTGVVSIEAAHATRNNARDDVAWKELPGYGRTLSGVTPWPRTDQVFEVGSGPSLEYDFYNFNTKG
GNLTTTVFVSPSLNALGNDHPLRIGVQLDSQDAQTTQFIPDAEPGQLPSAWNGIDGFVANSIVSVTGLWTNVEPG
AHTLKIWMVEPTVVVQKIVIDAGGLRSSYLGPPESLQYRVEIHLTVQVIFVTFFQETGFPPSPRVPSLLSLLLTC
QMSAEHSKMLPTIRPSSYVLPTIESHYEVEFDNPSSRMELGLLSITRNGNHGPVTSGGHSYPAHPKLNAQREKRR
SKDASSLSRVPEDDIAMEGRTHEVLEGPYEGSSSTPAYLGDQSLAADQEVEEEEEEEQLILDEELARQGIYRGSY
RRLQGLYSLTPLFTVLVFVFLAVLPTIAYPLSPDLPYAYNSGFPFPLPEVITATAFWGLSYLFHSPTFSFFFSII
SRVPILALALSSLSLSFVVTTLRQIVVPILLIPQYAVFDHPTWHDIAFRRVWWLALGWAAAEAIVGIKQGYEGIA
LYRDVLVNVRRVLPTPGGNSKFSSAYISKYAGGGHDSSRQYEASRNLADSVGSLNTERQPLLERLPSATSSASQS
DAQLKDAIEAAVEHDVDELLAMRGREELEDLYGMPFIHIPVFISCLHRLNSVLFILGSTLLVTAAYMRAPMSSLS
LLHNALHHKEKSGNTQLFIAFPLVIFLQWILILLHTPRILPRIGVQTFVYVGLIISLSTFFAGLGVWEGII*
Coding >Agabi119p4|784500
ATGGATAACACTTCTCAACCTTCCACTCCCGTTCGTGCTGAATCATTTTATTTCGATGATGATCCAATGGCTATA
TTTCTTGTCGATAATCAACTGTTCAAAGTCCATCGTCACTTTTTCATTGAAGAAGCCGAAGGGATGTCTGACGAC
AAACCTATCCTACTACCGAATGTGACTGTCAAAGAGTTCAAAACTCTTTTGCGATACTTCTATGCGATGAAGTCG
CCCACGTCCAATAAAAAGTTACTTGCCGATGTTTTTGCTTTTGAGCAAGACGAGAAGCTCGCTCTCCTTAGTGTT
GCTCATCAATTTTGTTTCGACCAAATTTATGAGTACATCCTTGGAGAGATTGAGCCTGGAACGTTTTCAGTAGTA
GACAGGGTGCGCCTAGGTGATAAATACGGTCTCAAAGATTGGCTCTCTTCGGCGTACGAGACCATTTTGGAACGT
ACTCCGGACCAAAAGCTGTCCCGGGAAGAAGTTGATGCATTGGGTCTCGACAGGACCGTCAGGATCCTTGAAGCG
AAAAATTTCGTGTTGCATAAAGTTCATGATCAATGTTTGGAAAAGTCGAATGTCCCAATTTGCACCAAAAGAAAC
CTTTTTCTGGAGCGCTGCGATTGTTGTACTCGGTGGATGGACTTCGAGAGCGCGGGAGGTTCAGCTGCCATTCGG
AAAATACAAAATAGTCCGGCTGAGGAATTGTTTGAACATGATTGGGACTTTGAGAATGACTATCATACATTGTTA
GATGGAAAATGGGACCATATGATGGATCAAACTCACCTCGGATATTATTACTGGCAACAGCCAATGACCAACTCC
ATGAACGCCATTAATCGCGTTCAGAAACGCAAACAAGCCCTCGCCGGCTACATGCGTATCAGTGTTGAAAGCTCA
AACGGAGCTTGGCCAGGTGATAATCCAAATCAATGCGCACAAGGATATAACTGTCCTCCTCCAACAGTCGCCCTT
GATTCATATTCGGTATTCTCCAACCGTTATATTGATATTGGAGCCGGAGGACCAGCGTCATTCTCATTCAAGATT
TCAAGTAATACTTCTTGGGTTGACATCTCCCCTTCCTCTGGAGATGTCTCCCCCCAGAACCCTGAGAAGAGAGTG
TTCTTAAGCGTGAAGGACTGGTCCAGCCTTAGTGATGGCGCCAATACGGCACAGCTGAAAGTGACTGCAAATTCG
AAGGGTCAACCTTCTATGACTGTTACTATCGATTTTTCAGCTACAAAAGCAGGATCTATTGGCGATTTCCATGGT
TTCGTCGAAGGGGACGGTGTTGTTTCCATGGAGGCAGCTCATGCCACGCGAAATACGACTGTGGATGGTATCTCT
TGGAAGAACTTCCCTGGCCTGGGAAGGACTCTATCTGGAGTCACACCTTGGCCTCGCAGCGATCAAGCCTTTGAT
GTCGGGACTGGTCCAATCTTGGAGTATGATTTCTTCACTTTCAACACTATCGCCGGATCCGGAAATATCACTGTT
ACAGCTCTACTCTCTCCCTCAAACAACGCGCAGGGACAAGACAACCCCTTGACTGTCGCTGTTGCTTTAGATTCC
GAAGAACCAATTGTCCACCAGCCTATGCCAGATTCTGCTGCTGGTAAACAGCCTGCTGCTTGGGATGGTGTCAAC
GGTTTCGCCGCCAACAATATCATACCCGTTGAGACTAAATTCACCAATATATCTGCAGGTAAACACACTTTCAAA
ATCATGATGACGCAGCCCGCCATTGTTGTGCAGAAGATTGTGATTGACGTTGGAGGATTGAAACCCAGTTATCTA
GGACCTCCAGAGAGTCACCGGTCATGTTACATTCGTAAATCATTCCGCATGGTCCGACTATTGCTCCTTGCAGGC
TTGTATGCCTTACTCAACGAAGCCCTTGCTATTGGGCAGGAGACCTGTGTTGCTTTCAGAGCCTCGAATTCAAGG
TTTCCTGTCGTCACGAAAAACCAAGCTGCACCTGTGCTAGTCTCCCCTGACGATTGGCCGGGTGTACAACGCGCA
GCCTCTGACTTCGTGACGGACATACAGCAGGTCACTGGTGCCAAAGTTTCTCTGATCAATGCGACAACGACAACG
AATCCTGGCAAGCAGGCCCCTATCATCGTCGGAACGCTTGGCAAATCATCCCTTATCGACGCCATTGTCAACTCT
ACAGGCCTCGACGTTTCCAACATTCAAGGACGTTGGGAGGCTTTCCTTTCTCGTGAAGTGCAGAATCCGCTACCT
GGAATCTCAAGTGCATACGTCATAATTGGCGCAGATAAACGTGGAACGATCTATGCGTTGTATGAACATTCCGAA
CAATTTGGCGTTTCTCCTTGGCATTGGTGGGCCGACGTTCCAACAACTCGACACTCCGAACTTTTTGTCGACTCA
ATAGGATGTTCTCATGGCTCACCAACTGTAAAGTACCGCGGCATATTTTTGAACGATGAACAGCCTGCACTTCAG
AACTGGGCCGCTGAGAAATTTACGAACGGTACAGGTGCTCCCAATACTGGATCCCCTTTCAACTCACAATTCTAT
ACAAAGATGTTCGAACTTATCTTGCGTTTGAAGGGAAACTACCTCTGGCCAGCGATCTGGAGCAGCGCATTTGCT
TTTGACGACCCGCAGAGCCAATTTCTCGCAGATATGTATGGTATCGTCATGGGTACCAGTCACCAAGAGCCAATG
ATGCGGTCTACTCCAGTAGAATTTAGCATCGAGTATCCGAATGTCGCCTGGGACTATGTTGCCAACAACGATACG
ATCAAAAAATACTGGTTAGAGGGTGTTCAACGTGCTAAAGACTTCGAATCCGTCTATACGATGGGTATGCGTGGT
TTCGGTGATCTGCCCCTGTCTGAGGAAACCAATATTGACCTCCTCGATCAGGTCATTCAGGATCAAACAGATATT
CTACATCAAGTTTTCGGACAAGATTTCGATGTTTCGACTATTCCTCAAATTTGGGCACTCTACAAGGAGGTTGAA
GGATACTATGAAGACGGCCTACAAGTACCCGATTATGTTACTTTGCTATGGAGTGACGACAACTGGGGAAATATC
CGTCGCTATCCCGTTGAATCAGAGCGCAACAGGACCGGTGGAGCTGGTGTCTATTATCATTTAGACTATGTTGGT
GACCCCCGTGACTACAAATGGATCGCTACAAGCCAAATTGAGAAAATTTACGAACAAATGTCCATAGCTGTCGAA
CGTGAGGCTACCCGCCTATGGATCATCAACGTTGGCGACATGAAACCCTACGAACGCGAGATTGAGTTCCTCCTC
GGTTATGGTTGGAATGCTACTCGCTGGTCGCCCGAGAACGTCAACGATTTCGTCTCTGCTTGGGCTCAACGCGAG
TTTGATGTCGACGAGAAGACGGCTGTTCAAGTCTCCGATATTGTGGCCAACTTGACGAGGTTCAATGCTCGGCGT
AAACCGGAACTTCTCACTGCGACTACTTACAGCTTGACCGATTATCGCGAAGCCGAGAACATATTTGCCGCTTGG
GAAGACCTGGAAAAATCGTCGACTACTGTATACAATAGTCTGGATGAGGACTTTAAACCTTCATTTTACCAGCTA
GTACATTACCCCGTGCTTGCGAGCAGCAACCTCGGCAAATTGTACATCCTTGCCGGTCAAAATAATCTTAGGGCG
TCCCAGGCCCGATTGAGCACCAATGTCCTTGCGGACACTGCTGTAGAGCTATTTGAGCATGACTTTGATCTGGAA
ACAGATTATCACCAACTCCTTGACGGTAAATGGGATCACATGATGCAACAAACTCGCATTGGCTACTACTATTGG
CAACAACCTATGGCTGACTCGATGCCCCCCGTCACCCGTGTCCAAGCTAAAAAGCAGGCTTTGGCCGGTGCCATG
AGGATTGTTCCCGAAGGTACCCAAGGAGCTTGGCCCGGCGATAATCCTCACCAATGTGCTGATGGCTTCAACTGT
CCCCCGCCTTCCGTTTCGTTGGACAATTTCTCACCCATCAGCAATCGCTATGTGGACGTTGGCGCTGGTGGCCCT
GCACCTTTCACTTTCACTGCTTCTAGTAATGCCACTTGGGTTAAACTTTCAGCTACTAAAGGCAGTATCTCACCC
AAGGCTCCTGAACAACGTGTCTACATCTCTGTGGCGGACTGGAGCCAGCTCCAGGATGGGATGAATACCGCTCAG
ATTCGTTTTACTGCTAAAGCTTCCGGTCAACCCGATCTATCCGTCAGCGTTTTTCTTAATGCTCTGAAAAACAAT
GTGGCTAGTGGTTTCAAGGGTTTCGTCGAAGGAACAGGTGTTGTTTCAATTGAAGCTGCGCATGCCACACGCAAC
AACGCCAGGGATGATGTTGCCTGGAAAGAACTGCCCGGATATGGACGTACGCTATCGGGTGTGACGCCTTGGCCC
CGCACCGATCAAGTCTTTGAAGTGGGTTCCGGACCTTCTTTGGAATACGATTTCTACAACTTCAATACTAAAGGT
GGTAACCTCACTACGACTGTATTCGTCTCCCCTTCTCTAAACGCTCTTGGCAACGATCATCCTCTACGTATTGGT
GTTCAACTCGATTCTCAAGATGCTCAGACTACACAATTCATTCCTGATGCCGAGCCTGGGCAATTACCTAGTGCC
TGGAACGGTATCGATGGTTTTGTTGCGAATTCCATTGTTTCTGTGACTGGCCTATGGACGAACGTCGAACCAGGT
GCACATACTCTCAAGATTTGGATGGTGGAACCTACTGTTGTTGTTCAAAAGATCGTGATTGATGCGGGAGGGCTT
CGGTCTAGCTATCTTGGGCCGCCTGAGAGTCTTCAGTACCGCGTGGAGATACATCTGACAGTGCAGGTGATATTT
GTCACTTTTTTTCAAGAAACGGGTTTTCCTCCGAGTCCAAGGGTCCCCTCCCTTCTCTCTCTCCTCCTCACTTGC
CAGATGTCAGCAGAACATTCAAAGATGCTACCGACCATTCGCCCGTCGTCTTATGTTTTGCCTACGATAGAATCA
CATTACGAAGTGGAATTTGACAACCCGTCGAGTAGGATGGAATTGGGATTGCTGAGTATTACCAGAAATGGAAAT
CATGGACCAGTGACATCAGGTGGTCACTCCTACCCCGCACACCCGAAACTTAACGCCCAGCGCGAGAAACGACGA
AGCAAAGACGCGTCGTCATTGAGCCGAGTTCCAGAGGACGATATAGCTATGGAGGGTCGTACTCATGAGGTTCTA
GAAGGTCCTTACGAGGGATCCAGTTCTACGCCAGCCTACTTGGGGGATCAGTCGCTTGCTGCAGACCAAGAAGTA
GAGGAGGAAGAGGAGGAAGAGCAGTTGATTCTGGATGAAGAGCTGGCTCGCCAGGGTATCTACCGAGGTTCATAT
CGCCGGCTGCAGGGGCTATACTCGCTTACGCCTTTGTTCACTGTCCTGGTCTTCGTATTCCTCGCCGTCCTTCCT
ACAATTGCTTATCCTCTTTCCCCCGACCTCCCATATGCTTACAATTCCGGCTTCCCCTTTCCTCTACCAGAAGTC
ATTACAGCCACTGCATTCTGGGGACTCTCATATCTCTTTCACTCTCCTACCTTCTCGTTCTTTTTCTCCATTATT
TCCCGTGTACCCATCCTCGCTCTCGCCCTAAGCTCTCTATCGCTCAGTTTCGTGGTCACAACTCTCCGACAAATA
GTTGTCCCAATCCTGCTCATTCCACAGTACGCTGTATTTGATCACCCTACATGGCATGATATCGCTTTCCGTCGT
GTCTGGTGGCTGGCACTTGGGTGGGCAGCAGCAGAAGCAATCGTAGGCATCAAGCAAGGCTACGAAGGAATTGCT
CTGTATAGGGACGTACTCGTCAACGTCAGGAGAGTGCTGCCAACACCGGGCGGAAATTCTAAATTCTCTAGCGCT
TACATATCCAAGTATGCTGGTGGGGGCCACGATAGCTCTAGGCAGTATGAAGCTTCGAGGAACCTTGCAGACTCT
GTAGGATCTCTTAATACAGAGAGACAACCTTTGTTGGAGCGCCTTCCTAGTGCTACTAGCAGCGCCTCGCAGAGT
GATGCACAGTTGAAGGATGCTATTGAGGCGGCGGTTGAGCACGATGTTGATGAGCTGCTCGCCATGCGCGGAAGG
GAAGAATTGGAAGATCTCTATGGCATGCCATTTATTCACATTCCTGTTTTTATTTCTTGTCTGCACAGACTCAAC
TCCGTTCTCTTCATTTTAGGGTCCACTCTACTGGTCACTGCTGCATATATGCGCGCGCCCATGTCCTCGTTATCT
CTCCTACACAATGCTCTTCACCACAAAGAGAAGTCTGGCAATACTCAACTCTTCATCGCTTTCCCTTTAGTCATA
TTTCTCCAATGGATCCTTATTCTCCTACATACTCCTCGAATTCTACCTCGCATCGGTGTCCAAACCTTTGTCTAC
GTTGGTCTTATAATTTCTCTTAGTACTTTCTTTGCGGGTTTGGGTGTTTGGGAAGGTATCATTTAA
Transcript >Agabi119p4|784500
ATGGATAACACTTCTCAACCTTCCACTCCCGTTCGTGCTGAATCATTTTATTTCGATGATGATCCAATGGCTATA
TTTCTTGTCGATAATCAACTGTTCAAAGTCCATCGTCACTTTTTCATTGAAGAAGCCGAAGGGATGTCTGACGAC
AAACCTATCCTACTACCGAATGTGACTGTCAAAGAGTTCAAAACTCTTTTGCGATACTTCTATGCGATGAAGTCG
CCCACGTCCAATAAAAAGTTACTTGCCGATGTTTTTGCTTTTGAGCAAGACGAGAAGCTCGCTCTCCTTAGTGTT
GCTCATCAATTTTGTTTCGACCAAATTTATGAGTACATCCTTGGAGAGATTGAGCCTGGAACGTTTTCAGTAGTA
GACAGGGTGCGCCTAGGTGATAAATACGGTCTCAAAGATTGGCTCTCTTCGGCGTACGAGACCATTTTGGAACGT
ACTCCGGACCAAAAGCTGTCCCGGGAAGAAGTTGATGCATTGGGTCTCGACAGGACCGTCAGGATCCTTGAAGCG
AAAAATTTCGTGTTGCATAAAGTTCATGATCAATGTTTGGAAAAGTCGAATGTCCCAATTTGCACCAAAAGAAAC
CTTTTTCTGGAGCGCTGCGATTGTTGTACTCGGTGGATGGACTTCGAGAGCGCGGGAGGTTCAGCTGCCATTCGG
AAAATACAAAATAGTCCGGCTGAGGAATTGTTTGAACATGATTGGGACTTTGAGAATGACTATCATACATTGTTA
GATGGAAAATGGGACCATATGATGGATCAAACTCACCTCGGATATTATTACTGGCAACAGCCAATGACCAACTCC
ATGAACGCCATTAATCGCGTTCAGAAACGCAAACAAGCCCTCGCCGGCTACATGCGTATCAGTGTTGAAAGCTCA
AACGGAGCTTGGCCAGGTGATAATCCAAATCAATGCGCACAAGGATATAACTGTCCTCCTCCAACAGTCGCCCTT
GATTCATATTCGGTATTCTCCAACCGTTATATTGATATTGGAGCCGGAGGACCAGCGTCATTCTCATTCAAGATT
TCAAGTAATACTTCTTGGGTTGACATCTCCCCTTCCTCTGGAGATGTCTCCCCCCAGAACCCTGAGAAGAGAGTG
TTCTTAAGCGTGAAGGACTGGTCCAGCCTTAGTGATGGCGCCAATACGGCACAGCTGAAAGTGACTGCAAATTCG
AAGGGTCAACCTTCTATGACTGTTACTATCGATTTTTCAGCTACAAAAGCAGGATCTATTGGCGATTTCCATGGT
TTCGTCGAAGGGGACGGTGTTGTTTCCATGGAGGCAGCTCATGCCACGCGAAATACGACTGTGGATGGTATCTCT
TGGAAGAACTTCCCTGGCCTGGGAAGGACTCTATCTGGAGTCACACCTTGGCCTCGCAGCGATCAAGCCTTTGAT
GTCGGGACTGGTCCAATCTTGGAGTATGATTTCTTCACTTTCAACACTATCGCCGGATCCGGAAATATCACTGTT
ACAGCTCTACTCTCTCCCTCAAACAACGCGCAGGGACAAGACAACCCCTTGACTGTCGCTGTTGCTTTAGATTCC
GAAGAACCAATTGTCCACCAGCCTATGCCAGATTCTGCTGCTGGTAAACAGCCTGCTGCTTGGGATGGTGTCAAC
GGTTTCGCCGCCAACAATATCATACCCGTTGAGACTAAATTCACCAATATATCTGCAGGTAAACACACTTTCAAA
ATCATGATGACGCAGCCCGCCATTGTTGTGCAGAAGATTGTGATTGACGTTGGAGGATTGAAACCCAGTTATCTA
GGACCTCCAGAGAGTCACCGGTCATGTTACATTCGTAAATCATTCCGCATGGTCCGACTATTGCTCCTTGCAGGC
TTGTATGCCTTACTCAACGAAGCCCTTGCTATTGGGCAGGAGACCTGTGTTGCTTTCAGAGCCTCGAATTCAAGG
TTTCCTGTCGTCACGAAAAACCAAGCTGCACCTGTGCTAGTCTCCCCTGACGATTGGCCGGGTGTACAACGCGCA
GCCTCTGACTTCGTGACGGACATACAGCAGGTCACTGGTGCCAAAGTTTCTCTGATCAATGCGACAACGACAACG
AATCCTGGCAAGCAGGCCCCTATCATCGTCGGAACGCTTGGCAAATCATCCCTTATCGACGCCATTGTCAACTCT
ACAGGCCTCGACGTTTCCAACATTCAAGGACGTTGGGAGGCTTTCCTTTCTCGTGAAGTGCAGAATCCGCTACCT
GGAATCTCAAGTGCATACGTCATAATTGGCGCAGATAAACGTGGAACGATCTATGCGTTGTATGAACATTCCGAA
CAATTTGGCGTTTCTCCTTGGCATTGGTGGGCCGACGTTCCAACAACTCGACACTCCGAACTTTTTGTCGACTCA
ATAGGATGTTCTCATGGCTCACCAACTGTAAAGTACCGCGGCATATTTTTGAACGATGAACAGCCTGCACTTCAG
AACTGGGCCGCTGAGAAATTTACGAACGGTACAGGTGCTCCCAATACTGGATCCCCTTTCAACTCACAATTCTAT
ACAAAGATGTTCGAACTTATCTTGCGTTTGAAGGGAAACTACCTCTGGCCAGCGATCTGGAGCAGCGCATTTGCT
TTTGACGACCCGCAGAGCCAATTTCTCGCAGATATGTATGGTATCGTCATGGGTACCAGTCACCAAGAGCCAATG
ATGCGGTCTACTCCAGTAGAATTTAGCATCGAGTATCCGAATGTCGCCTGGGACTATGTTGCCAACAACGATACG
ATCAAAAAATACTGGTTAGAGGGTGTTCAACGTGCTAAAGACTTCGAATCCGTCTATACGATGGGTATGCGTGGT
TTCGGTGATCTGCCCCTGTCTGAGGAAACCAATATTGACCTCCTCGATCAGGTCATTCAGGATCAAACAGATATT
CTACATCAAGTTTTCGGACAAGATTTCGATGTTTCGACTATTCCTCAAATTTGGGCACTCTACAAGGAGGTTGAA
GGATACTATGAAGACGGCCTACAAGTACCCGATTATGTTACTTTGCTATGGAGTGACGACAACTGGGGAAATATC
CGTCGCTATCCCGTTGAATCAGAGCGCAACAGGACCGGTGGAGCTGGTGTCTATTATCATTTAGACTATGTTGGT
GACCCCCGTGACTACAAATGGATCGCTACAAGCCAAATTGAGAAAATTTACGAACAAATGTCCATAGCTGTCGAA
CGTGAGGCTACCCGCCTATGGATCATCAACGTTGGCGACATGAAACCCTACGAACGCGAGATTGAGTTCCTCCTC
GGTTATGGTTGGAATGCTACTCGCTGGTCGCCCGAGAACGTCAACGATTTCGTCTCTGCTTGGGCTCAACGCGAG
TTTGATGTCGACGAGAAGACGGCTGTTCAAGTCTCCGATATTGTGGCCAACTTGACGAGGTTCAATGCTCGGCGT
AAACCGGAACTTCTCACTGCGACTACTTACAGCTTGACCGATTATCGCGAAGCCGAGAACATATTTGCCGCTTGG
GAAGACCTGGAAAAATCGTCGACTACTGTATACAATAGTCTGGATGAGGACTTTAAACCTTCATTTTACCAGCTA
GTACATTACCCCGTGCTTGCGAGCAGCAACCTCGGCAAATTGTACATCCTTGCCGGTCAAAATAATCTTAGGGCG
TCCCAGGCCCGATTGAGCACCAATGTCCTTGCGGACACTGCTGTAGAGCTATTTGAGCATGACTTTGATCTGGAA
ACAGATTATCACCAACTCCTTGACGGTAAATGGGATCACATGATGCAACAAACTCGCATTGGCTACTACTATTGG
CAACAACCTATGGCTGACTCGATGCCCCCCGTCACCCGTGTCCAAGCTAAAAAGCAGGCTTTGGCCGGTGCCATG
AGGATTGTTCCCGAAGGTACCCAAGGAGCTTGGCCCGGCGATAATCCTCACCAATGTGCTGATGGCTTCAACTGT
CCCCCGCCTTCCGTTTCGTTGGACAATTTCTCACCCATCAGCAATCGCTATGTGGACGTTGGCGCTGGTGGCCCT
GCACCTTTCACTTTCACTGCTTCTAGTAATGCCACTTGGGTTAAACTTTCAGCTACTAAAGGCAGTATCTCACCC
AAGGCTCCTGAACAACGTGTCTACATCTCTGTGGCGGACTGGAGCCAGCTCCAGGATGGGATGAATACCGCTCAG
ATTCGTTTTACTGCTAAAGCTTCCGGTCAACCCGATCTATCCGTCAGCGTTTTTCTTAATGCTCTGAAAAACAAT
GTGGCTAGTGGTTTCAAGGGTTTCGTCGAAGGAACAGGTGTTGTTTCAATTGAAGCTGCGCATGCCACACGCAAC
AACGCCAGGGATGATGTTGCCTGGAAAGAACTGCCCGGATATGGACGTACGCTATCGGGTGTGACGCCTTGGCCC
CGCACCGATCAAGTCTTTGAAGTGGGTTCCGGACCTTCTTTGGAATACGATTTCTACAACTTCAATACTAAAGGT
GGTAACCTCACTACGACTGTATTCGTCTCCCCTTCTCTAAACGCTCTTGGCAACGATCATCCTCTACGTATTGGT
GTTCAACTCGATTCTCAAGATGCTCAGACTACACAATTCATTCCTGATGCCGAGCCTGGGCAATTACCTAGTGCC
TGGAACGGTATCGATGGTTTTGTTGCGAATTCCATTGTTTCTGTGACTGGCCTATGGACGAACGTCGAACCAGGT
GCACATACTCTCAAGATTTGGATGGTGGAACCTACTGTTGTTGTTCAAAAGATCGTGATTGATGCGGGAGGGCTT
CGGTCTAGCTATCTTGGGCCGCCTGAGAGTCTTCAGTACCGCGTGGAGATACATCTGACAGTGCAGGTGATATTT
GTCACTTTTTTTCAAGAAACGGGTTTTCCTCCGAGTCCAAGGGTCCCCTCCCTTCTCTCTCTCCTCCTCACTTGC
CAGATGTCAGCAGAACATTCAAAGATGCTACCGACCATTCGCCCGTCGTCTTATGTTTTGCCTACGATAGAATCA
CATTACGAAGTGGAATTTGACAACCCGTCGAGTAGGATGGAATTGGGATTGCTGAGTATTACCAGAAATGGAAAT
CATGGACCAGTGACATCAGGTGGTCACTCCTACCCCGCACACCCGAAACTTAACGCCCAGCGCGAGAAACGACGA
AGCAAAGACGCGTCGTCATTGAGCCGAGTTCCAGAGGACGATATAGCTATGGAGGGTCGTACTCATGAGGTTCTA
GAAGGTCCTTACGAGGGATCCAGTTCTACGCCAGCCTACTTGGGGGATCAGTCGCTTGCTGCAGACCAAGAAGTA
GAGGAGGAAGAGGAGGAAGAGCAGTTGATTCTGGATGAAGAGCTGGCTCGCCAGGGTATCTACCGAGGTTCATAT
CGCCGGCTGCAGGGGCTATACTCGCTTACGCCTTTGTTCACTGTCCTGGTCTTCGTATTCCTCGCCGTCCTTCCT
ACAATTGCTTATCCTCTTTCCCCCGACCTCCCATATGCTTACAATTCCGGCTTCCCCTTTCCTCTACCAGAAGTC
ATTACAGCCACTGCATTCTGGGGACTCTCATATCTCTTTCACTCTCCTACCTTCTCGTTCTTTTTCTCCATTATT
TCCCGTGTACCCATCCTCGCTCTCGCCCTAAGCTCTCTATCGCTCAGTTTCGTGGTCACAACTCTCCGACAAATA
GTTGTCCCAATCCTGCTCATTCCACAGTACGCTGTATTTGATCACCCTACATGGCATGATATCGCTTTCCGTCGT
GTCTGGTGGCTGGCACTTGGGTGGGCAGCAGCAGAAGCAATCGTAGGCATCAAGCAAGGCTACGAAGGAATTGCT
CTGTATAGGGACGTACTCGTCAACGTCAGGAGAGTGCTGCCAACACCGGGCGGAAATTCTAAATTCTCTAGCGCT
TACATATCCAAGTATGCTGGTGGGGGCCACGATAGCTCTAGGCAGTATGAAGCTTCGAGGAACCTTGCAGACTCT
GTAGGATCTCTTAATACAGAGAGACAACCTTTGTTGGAGCGCCTTCCTAGTGCTACTAGCAGCGCCTCGCAGAGT
GATGCACAGTTGAAGGATGCTATTGAGGCGGCGGTTGAGCACGATGTTGATGAGCTGCTCGCCATGCGCGGAAGG
GAAGAATTGGAAGATCTCTATGGCATGCCATTTATTCACATTCCTGTTTTTATTTCTTGTCTGCACAGACTCAAC
TCCGTTCTCTTCATTTTAGGGTCCACTCTACTGGTCACTGCTGCATATATGCGCGCGCCCATGTCCTCGTTATCT
CTCCTACACAATGCTCTTCACCACAAAGAGAAGTCTGGCAATACTCAACTCTTCATCGCTTTCCCTTTAGTCATA
TTTCTCCAATGGATCCTTATTCTCCTACATACTCCTCGAATTCTACCTCGCATCGGTGTCCAAACCTTTGTCTAC
GTTGGTCTTATAATTTCTCTTAGTACTTTCTTTGCGGGTTTGGGTGTTTGGGAAGGTATCATTTAA
Gene >Agabi119p4|784500
ATGGATAACACTTCGTAAGGCGAGCTTATGGATCAAGCATTGAGCCGAAACCTGACATTCATGTTTGGATTTGAA
TTTGAGCAGTCAACCTTCCACTCCCGTTCGTGCTGAATCATTTTATTTCGATGATGATCCAATGGCTATATTTCT
TGTGAGTCATCTTATGCAGCCATCCTAGTCACAAATTAGCTTGACTGACTATACGATGTAGGTCGATAATCAACT
GTTCAAAGTCCATCGTCACTTTTTCATTGAAGGTTCCCAAATTTTTCGAGATATGTTTTCTCAGGGCAAAACCTG
TGAAGAAGCCGAAGGGATGTCTGACGACAAACCTATCCTACTACCGAATGTGACTGTCAAAGAGTTCAAAACTCT
TTTGCGATACTTCTATGCGATGTGAATACTTTCGGGTTTCTTCTTCACGACCGCGCAACTCACACTACCCATTAT
TCGGATAGGAAGTCGCCCACGTCCAATAAAAAGTTACTTGCCGATGTTTTTGCTTTTGAGCAAGACGAGAAGCTC
GCTCTCCTTAGTGTTGCTCATCAATTTTGTTTCGACCAAATTTATGAGTACATCCTTGGAGAGATTGAGCCTGGA
ACGTTTTCAGTAGTAGACAGGGTGCGCCTAGGTGATAAATACGGTCTCAAAGATTGGCTCTCTTCGGCGTACGAG
ACCATTTTGGAACGTACTCCGGACCAAAAGCTGTCCCGGGAAGAAGTTGATGCATTGGGTCTCGACAGGACCGTC
AGGATCCTTGAAGCGAAAAATTTCGTGTTGCATAAAGTTCATGATCAATGTTTGGAAAAGTCGAATGTCCCAATT
TGCACCAAAAGAAACCTTTTTCTGGAGCGCTGCGATTGTTGTACTCGGTGGATGGACTTCGAGAGCGCGGGAGGT
TCAGCTGCCATTCGGAAAAGTGATGTCGCTCTAGCAGTAGAGAATCTTTTGTCGTAAGTAATGGGGTCAACAGTA
CAAAATAGTCCGGCTGAGGAATTGTTTGAACATGATTGGGACTTTGAGAATGACTATCATACATTGTTAGATGGT
ACGTTCAAAGCCTACGTTACTCGTTCAATGTCGCTAATATTGCCCATTCAGGAAAATGGGACCAGTAAGCTGATT
TATCGATCATATAAAAGTACAATGATGAACCCGACATTAGTATGATGGATCAAACTCGTACGTTTTCATGAGTAA
CTAGTATACCGCCTGATCAATGAACAACTCAGACCTCGGATATTATTACTGGCAACAGCCAATGACCAACTCGTA
CGCAAATTCAATCCCCATCAACGTTTGATAAGTTAGATTAATCATTGTAATAGCATGAACGCCATTAATCGCGTT
CAGAAACGCAAACAAGCCCTCGCCGGCTACATGCGTATCAGTGTTGAAAGCTCAAACGGAGCTTGGTGCGAACTT
TTCTGGAGCCTAGAACGTTTGACGTCCTGACATGCTCTCTCACAGGCCAGGTGATAATCCAAATCAATGCGCACA
AGGATATAACTGTCCTCCTCCAACAGTCGCCCTTGATTCATATTCGGTATTCTCCAACCGTTATATTGATATTGG
AGCCGGAGGACCAGCGTCATTCTCATTCAAGATTTCAAGTAATACTTCTTGGGTTGACATCTCCCCTTCCTCTGG
AGATGTCTCCCCCCAGAACCCTGAGAAGAGAGTGTTCTTAAGCGTGAAGGACTGGTCCAGCCTTAGTGATGGCGC
CAATACGGCACAGCTGAAAGTGACTGCAAATTCGAAGGGTCAACCTTCTATGACTGTTACTATCGATTTTTCAGC
TACAAAAGCAGGATCTATTGGCGATTTCCATGGTATATGGCCCTCCGTTCTTGATATCCAGTAATTATTGGGCTC
ATCAATGGTGCTAGGTTTCGTCGAAGGGGACGGTGTTGTTTCCATGGAGGCAGCTCATGCCACGCGAAATACGAC
TGTGGATGGTATCTCTTGGAAGAACTTCCCTGGCCTGGGAAGGACTCTATCTGGAGTCACACCTTGGCCTCGCAG
CGATCAAGCCTTTGATGTCGGGACTGGTCCAATCTTGTGCGTGATAGTCTTAACCTAACTAAGTCACGGAATTGA
CGGCAGTCTGTTAGGGAGTATGATTTCTTCACTTTCAACACTATCGCCGGATCCGGAAATATCACTGTTACAGCT
CTACTCTCTCCCTCAAACAACGCGCAGGGACAAGACAACCCCTTGACTGTCGCTGTTGCTTTAGATTCCGAAGAA
CCAATTGTCCACCAGCCTATGCCAGATTCTGCTGCTGGTAAACAGCCTGCTGCTTGGGATGGTGTCAACGGTTTC
GCCGCCAACAATATCATACCCGTTGAGACTAAATTCACCAATATATCTGCAGGTAAACACACTTTCAAAGTAAGT
CATATGTTCTGCTTTATTTGATCAAATACTCAAGTATTGAAAACAGATCATGATGACGCAGCCCGCCATTGTTGT
GCAGAAGATTGTGATTGGTGAGCTCGGTCGCTTTCAGACACACCTTACTCCTTTTCTAACTTGTTCAGACGTTGG
AGGATTGAAACCCAGTTATCTAGGACCTCCAGAGAGTCACCGGGTTTAAGAATTTTTATCATACATATCCAAAAT
TAAATCTTTTCTCTACATGTGTCAACCACGTGGAGTTTGGCATGTTGTTCGGGTCATCCATCCGGACCGCGTACT
TATTCCGAGTTCCGTCGCATCAAACCAAACAAAATTCAATAGTCTATTTTGAGCTTGGTCGTGTATTCCATCTTC
CATGTTCGACCCTCTATTCTGCATATGTTCCAACGCCAGCCACGATTAATCGCCGCATTCAGGTAATAGTGCTGA
AATCAAGCTGACCTTTCGCTACATAGTTTTTCCAATAAGGGGAGGACCCCCTTTCCTTTGTTCACCGAATAGGCT
CCAAAGCCTAAGGAGCCAATAGCGGTGTCAATCAAGAGGCAGCTGAGGAACAAATGCCAAGATCTCTTGCATTGC
GCCTTCGAAAATCTCCGAGATTTATGCATACGTGGTCATAAGGTCGTTCAACAACTTGGGCGGTGGAGCAGTCAT
GTTACATTCGTAAATCATTCGTAAGTAGATGAAATAGAACAACCTTACAAGAATGTTGCACTTGATATCTTCAGA
CTGGTTTCACATATTGACTGACCTTTAGCGCATGGTCCGACTATTGCTCCTTGCAGGCTTGTATGCCTTACTCAA
CGAAGCCCTTGCTATTGGGCAGGAGACCTGTGTTGCTTTCAGAGCCTCGAATTCAAGGTTTCCTGTCGTCACGAA
AAACCAAGCTGCACCTGTGCTAGTCTCCCCTGACGATTGGCCGGGTGTACAACGCGCAGCCTCTGACTTCGTGAC
GGACATACAGCAGGTCACTGGTGCCAAAGTTTCTCTGATCAATGCGACAACGACAACGAATCCTGGCAAGCAGGC
CCCTATCATCGTCGGAACGCTTGGCAAATCATCCCTTATCGACGCCATTGTCAACTCTACAGGCCTCGACGTTTC
CAACATTCAAGGACGTTGGGAGGCTTTCCTTTCTCGTGAAGTGCAGAATCCGCTACCTGGAATCTCAAGTGCATA
CGTCATAATTGGCGCAGATAAACGTGGAACGATCTATGCGTTGTATGAACATTCCGAACAATTTGGTATATTTTT
TACGTCGTATGACGCCTTCAATCGTCTTTTCTTAACTTACCACATTCCTGACAGGCGTTTCTCCTTGGCATTGGT
TAGTCAAGGGTTACATCAGGTTTGGGAATTATTTGACTGATGAAGTCTGTAGGTGGGCCGACGTTCCAACAACTC
GACACTCCGAACTTTTTGTCGACTCAATAGGATGTTCTCATGGCTCACCAACTGTAAAGTACCGCGGCATATTTT
TGAACGATGAACAGCCTGCACTTCAGAACTGGGCCGCTGAGAAATTTACGAACGGTACAGGTGCTCCCAATACTG
GATCCCCTTTCAACTCACAATTCTATACAAAGATGTACGTTCGGATCTGACTAAACCATCTACTTTCCTTGACTT
TGGTATTCAGGTTCGAACTTATCTTGCGTTTGAAGGGAAACTACCTCTGGCCAGCGATCTGGAGCAGGTATGTAG
CTGTTGACACATCTTCTGATGTGAATCTGATCCATTCCAATCGCAGCGCATTTGCTTTTGACGACCCGCAGAGCC
AATTTCTCGCAGATATGTATGGTATCGTCATGGGTACCAGGCAGGTTTTCGGTCTAAACCTCGCTCACTTTAGCT
AACAAGCATCCAGTCACCAAGAGCCAATGATGCGGTCTACTCCAGTAGAATTTAGCATCGAGTATCCGAATGTCG
CCTGGGACTATGTTGCCAACAACGATACGATCAAAAAATACTGGTTAGAGGGTGTTCAACGTGCTAAAGACTTCG
AATCCGTCTATACGATGGGTATGCGTGGTTTCGGTGATCGTGAGTCGTCACTTCGGTCCCAATGCGTTCAAAACG
CTGATAAATACAGTGCCCCTGTCTGAGGAAACCAATATTGACCTCCTCGATCAGGTCATTCAGGATCAAACAGAT
ATTCTACATCAAGTTTTCGGACAAGATTTCGATGTTTCGACTATTCCTCAAATTTGGGCACTCTGTTAGTTCATT
ATCAAAGCAGGGGCATACGACTGAGTTTATTATATAGACAAGGAGGTTGAAGGATACTATGAAGACGGCCTACAA
GTACCCGATTATGTTACTTTGCTATGGAGTGACGACAAGTAAGTGAACATCGTTATATTCCCTTGATCATCCTTC
ACGAAAACGATAGCTGGGGAAATATCCGTCGCTATCCCGTTGAATCAGAGCGCAACAGGACCGGTGGAGCTGGTG
TCTATTATCATGTGAGTTATTGTTTTCATGACATTTGCTGAGACCAACATCAATTACTTCTAGTTAGACTATGTA
GGTATTGTAATCCTCCTGGCTTAGCGTGTCTGATGAGCGACCAGGTTGGTGACCCCCGTGACTACAAATGGATCG
CTGTGAGTTTTTTTGAGATACTTTCAATCGCATTGCATTGATGGTCTGCTTTCAGACAAGCCAAATTGAGAAAAT
TTACGAACAAATGTCCATAGCTGTCGAACGTGAGGCTACCCGCCTATGGATCATCAACGTTGGCGACATGAAACC
CTACGAACGCGAGATTGAGTTCCTCCTCGGTTATGGTTGGAATGCTACTCGCTGGTCGCCCGAGAACGTCAACGA
TTTCGTCTCTGCTTGGGCTCAACGCGAGTTTGATGTCGACGAGAAGACGGCTGTTCAAGTCTCCGATATTGTGGC
CAACTTGACGAGGTTCAATGCTCGGCGTAAACCGGAACTTCTCACTGCGACTACTTACAGCTTGACCGATTATCG
CGAGTAAGTCTTGCTGCCTACTCGAGGGATTTTGATGGTGATAAGATTCTTCTCTGATCAATATAGAGCCGAGAA
CATATTTGCCGCTTGGGAAGACCTGGAAAAATCGTCGACTACTGTATACAATAGTCTGGATGAGGACTTTAAACC
TTCATTTTACCAGCTAGTACATTACCCCGTGCTTGCGAGCAGCAACCTCGGCAAATTGGTATCTCTTCCGGTCTT
ATCTTTTGTATGCCAAGCTGAATGTATCGCTACAGTACATCCTTGCCGGTCAAAATAATCTTAGGGCGTCCCAGG
CCCGAGTGCGTTAGATTATCCATATGGAGACTCACTTCAATATTGACGAACTGATAGTTGAGCACCAATGTCCTT
GCGGACACTGCTGTAGAGCTATTTGAGCATGACTTTGATCTGGAAACAGATTATCACCAACTCCTTGACGGTAAA
TGGGATCAGTAAGTTTATTAGTTTGAGTGGGAAAGGAACGCGTTAACCGAAGTTCTAGCATGATGCAACAAACTC
GCATTGGCTACTACTATTGGCAACAACCTATGGCTGACTCGTAAGCATTTCAGCGTAAAAAGCTTTCACCGTCCG
TCTCAGTCTTTCCTAGGATGCCCCCCGTCACCCGTGTCCAAGCTAAAAAGCAGGCTTTGGCCGGTGCCATGAGGA
TTGTTCCCGAAGGTACCCAAGGAGCTTGGTGAGTACCTTTAAGCAGCGCTCTCATACTTGCTAAACCTTTGCTCC
ATCAAGGCCCGGCGATAATCCTCACCAATGTGCTGATGGCTTCAACTGTCCCCCGCCTTCCGTTTCGTTGGACAA
TTTCTCACCCATCAGCAATCGCTATGTGGACGTTGGCGCTGGTGGCCCTGCACCTTTCACTTTCACTGCTTCTAG
TAATGCCACTTGGGTTAAACTTTCAGCTACTAAAGGCAGTATCTCACCCAAGGCTCCTGAACAACGTGTCTACAT
CTCTGTGGCGGACTGGAGCCAGCTCCAGGATGGGATGAATACCGCTCAGATTCGTTTTACTGCTAAAGCTTCCGG
TCAACCCGATCTATCCGTCAGCGTTTTTCTTAATGCTCTGAAAAACAATGTGGCTAGTGGTTTCAAGGGTTTGTA
AAGAATTCGCACTCCCATAGACCGTATCCAATGACGATTGACTACAGGTTTCGTCGAAGGAACAGGTGTTGTTTC
AATTGAAGCTGCGCATGCCACACGCAACAACGCCAGGGATGATGTTGCCTGGAAAGAACTGCCCGGATATGGACG
TACGCTATCGGGTGTGACGCCTTGGCCCCGCACCGATCAAGTCTTTGAAGTGGGTTCCGGACCTTCTTTGTATGT
TCTCGACTCTGTGGTCGTTCTGAGGCTGATACTGTCCAACATCAGGGAATACGATTTCTACAACTTCAATACTAA
AGGTGGTAACCTCACTACGACTGTATTCGTCTCCCCTTCTCTAAACGCTCTTGGCAACGATCATCCTCTACGTAT
TGGTGTTCAACTCGATTCTCAAGATGCTCAGACTACACAATTCATTCCTGATGCCGAGCCTGGGCAATTACCTAG
TGCCTGGAACGGTATCGATGGTTTTGTTGCGAATTCCATTGTTTCTGTGACTGGCCTATGGACGAACGTCGAACC
AGGTGCACATACTCTCAAGATTTGGATGGTGGAACCTACTGTTGTTGTTCAAAAGATCGTGATTGGTATGTGTAT
CGTTTGCTTTTACTTGGTTTGGTGGAAGTTGACTAGTTATGGGAAGATGCGGGAGGGCTTCGGTCTAGCTATCTT
GGGCCGCCTGAGAGTCTTCAGGTTTAAGCTTTTAGATCGTTATTACCTTTCGGTGGCGTTCGTTTACTACACCCG
AGTACCACTCGTTTGAAATTATAAGTGCTGGAATCTGACTTGTTTTTTTCCTTGTTTCGAAGGATCCGCTCGAGC
GTAAGATGATTCAAAGTTATTGTATACAACGAGAAATCAATTATCTTTGATCAGCGTCCTTTCATCTAACCGATG
AAAGTGCTGAAGGTGACGTATATTATTACTCCCTGAGCTCCACCACCGGGTATTACTGAACTTGATTAGGAATGT
TCTAAGATTGGAACACATTCTTAGTCTATATGCTACCCTGGATGTTCTCCGCCGACGTGGAACTCTTCTTTCAAA
AGTTGAATGTGTAGCATTGTATTTGCGCGCGGTGAAGCTTCTCTGGAAGCCTTCCAGATTCCAACCTCCGTGGTT
CCCTGACTGATGATCATTTGATGGCACATCACCCATTTCTTTCTTGCAGCAAGTGAAGTACTGAGTTTCTGTGAG
TTTCGCATGGGGCGAAATTCGCTCATTGACGACATTTCCGGTGCTAAATTGGAAATTAAGATAGCTTTGCAAATG
CATGGTTATAAGCAAGGCTAGTAGTGGTTCCACTCTAATTGCTTAGTAGGGAGACTCAACAATCGTTCCACTGCT
TTCTCCGTTTTTCTCTTGTTGGCATATCTCTCCTTTTACGGCAGTACCGCGTGGAGATACATCTGACAGTGCAGG
TAAAGCGCAATTCACTTCTGGGTCGACCCGTTATCTCGCTAAAAATTTGCGATAAGGTGATATTTGTCACTTTTT
TTCAAGAAACGGGTGTGAATTTCTAAGGAGGAAACAGTATATCAGAAATCCTTATTGCACGCAAAAGGTTTTCCT
CCGAGTCCAAGGGTCCCCTCCCTTCTCTCTCTCCTCCTCACTTGCCAGATGTCAGCAGAACATTCAAAGATGCTA
CCGACCATTCGCCCGTCGTCTTATGTTTTGCCTACGATAGAATCACATTACGAAGTGGAATTTGACAACCCGTCG
AGTAGGATGGAATTGGGATTGCTGAGTATTACCAGAAATGGAAATCATGGACCAGTGACATCAGGTGGTCACTCC
TACCCCGCACACCCGAAACTTAACGCCCAGCGCGAGAAACGACGAAGCAAAGACGCGTCGTCATTGAGCCGAGTT
CCAGAGGACGATATAGCTATGGAGGGTCGTACTCATGAGGTTCTAGAAGGTCCTTACGAGGGATCCAGTTCTACG
CCAGCCTACTTGGGGGATCAGTCGCTTGCTGCAGACCAAGAAGTAGAGGAGGAAGAGGAGGAAGAGCAGTTGATT
CTGGATGAAGAGCTGGCTCGCCAGGGTATCTACCGAGGTACAGCTTGACTCTCTTTGTTTTGGCGGAGACTGGAC
TGAAATTTGAACAGGTTCATATCGCCGGCTGCAGGGGCTATACTCGCTTACGCCTTTGTTCACTGTCCTGGTCTT
CGTATTCCTCGCCGTCCTTCCTACAATTGCTTATCCTCTTTCCCCCGACCTCCCATATGCTTACAATTCCGGCTT
CCCCTTTCCTCTACCAGAAGTCATTACAGCCACTGCATTCTGGGGACTCTCATATCTCTTTCACTCTCCTACCTT
CTCGTTCTTTTTCTCCATTATTTCCCGTGTACCCATCCTCGCTCTCGCCCTAAGCTCTCTATCGCTCAGTTTCGT
GGTCACAACTCTCCGACAAATAGTTGTCCCAATCCTGCTCATTCCACAGTACGCTGTATTTGATCACCCTACATG
GCATGATATCGCTTTCCGTCGTGTCTGGTGGCTGGCACTTGGGTGGGCAGCAGCAGAAGCAATCGTAGGCATCAA
GCAAGGCTACGAAGGAATTGCTCTGTATAGGGACGTACTCGTCAACGTCAGGAGAGTGCTGCCAACACCGGGCGG
AAATTCTAAATTCTCTAGCGCTTACATATCCAAGTATGCTGGTGGGGGCCACGATAGCTCTAGGCAGTATGAAGC
TTCGAGGAACCTTGCAGACTCTGTAGGATCTCTTAATACAGAGAGACAACCTTTGTTGGAGCGCCTTCCTAGTGC
TACTAGCAGCGCCTCGCAGAGTGATGCACAGTTGAAGGATGCTATTGAGGCGGCGGTTGAGCACGATGTTGATGA
GCTGCTCGCCATGCGCGGAAGGGAAGAATTGGAAGATCTCTATGGCATGCCATTTATTGTGAGTATAACACTTAT
TTTTCATTCTTCACGGCTGATGCGCTTTTTCATTAGCACATTCCTGTTTTTATTTCTTGTCTGCACAGACTCAAC
TCCGTTCTCTTCATTTTAGGGTCCACTCTACTGGTCACTGCTGCATATATGCGCGCGCCCATGTCCTCGTTATCT
CTCCTACACAATGCTCTTCACCACAAAGAGAAGTCTGGCAATACTCAACTCTTCATCGCTTTCCCTTTAGTCATA
TTTCTCCAATGGATCCTTATTCTCCTACATACTCCTCGAATTCTACCTCGCATCGGTGTCCAAACCTTTGTCTAC
GTTGGTCTTATAATTTCTCTTAGTACTTTCTTTGCGGGTTTGGGTGTTTGGGAAGGTATCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail