Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|782800
Gene name
Locationscaffold_13:283746..288859
Strand+
Gene length (bp)5113
Transcript length (bp)3855
Coding sequence length (bp)3855
Protein length (aa) 1285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07774 EMC1_C ER membrane protein complex subunit 1, C-terminal 4.5E-69 812 1017
PF13360 PQQ_2 PQQ-like domain 1.2E-05 47 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 21 1013 1.0E-56
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 20 1013 1.0E-54
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 414 1013 6.0E-51
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 414 1013 7.0E-50
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 424 1013 2.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8C7X2|EMC1_MOUSE ER membrane protein complex subunit 1 OS=Mus musculus GN=Emc1 PE=1 SV=1 21 1013 1.0E-56
sp|Q5ZL00|EMC1_CHICK ER membrane protein complex subunit 1 OS=Gallus gallus GN=EMC1 PE=2 SV=1 20 1013 1.0E-54
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 414 1013 6.0E-51
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 414 1013 7.0E-50
sp|Q6NRB9|EMC1_XENLA ER membrane protein complex subunit 1 OS=Xenopus laevis GN=emc1 PE=2 SV=1 424 1013 2.0E-47
sp|O13981|EMC1_SCHPO ER membrane protein complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emc1 PE=3 SV=1 707 1017 7.0E-38
sp|P25574|EMC1_YEAST ER membrane protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC1 PE=1 SV=1 707 1009 8.0E-23
sp|Q5R7K6|EMC1_PONAB ER membrane protein complex subunit 1 OS=Pongo abelii GN=EMC1 PE=2 SV=1 17 254 2.0E-06
sp|Q8N766|EMC1_HUMAN ER membrane protein complex subunit 1 OS=Homo sapiens GN=EMC1 PE=1 SV=1 19 254 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|782800
MRQLFFVFLLALQSCLVHAVHKSDVGLIDWYKQLVGVPLTTTANSPTFHHVGGRDILLTATMSNVLAALDAEDGQ
VAWRYIFEGEDMIAGYYAHDNVVVTLSGTGGEILRTFDIQTGVLLLEKQLHLPQLGHRAEPHTFGKHVVFGDNNS
TDIYVLTNGYNFARMNRETGETYWEFASPDASSLVIHSKLVLTPSALYLIGIAKSLQSYTLHVTSLNPKTGELIS
TANIPSSIENPINGFQVLSNGISDNNRIVWLEHGTLKHVLLVPKLTSKPVSVQQAEFESFVDVGLSKDAHIVAIK
TDGAARVIKLIEDGITGVYDFKNEATTNEEQRFPVYSGNVEETGRVHVARVYWKQDVKQVALEIYSGTPDLSFSL
FDFDTLNNGVINFAALNARGTGSNDIAPRLLILTYTGNVQLVEGTQVKWNREEALTSSVVAEFAELPPPKAVVGD
HEGESFVSRVIRHIADLQKLPAYILHFLKRFVMNQSSVLTTKNNIQSDEAVRDEFGFRQIIVVATMFGKVYGIDS
ATGSVVWMRLLGLGWAANGGARLAPLKLYTFNGEGVGGEGKGARSDVVLIVQRTAANTLVDTVLFHIDAATGQDL
TGKTAGSDVLEGIDIVPGVMVESYMLQLKGQKLVMLLDEYLQTYTYPDTPEAYDLLKEVASSLYFPLRTNSKLPS
PPGSPRQRHLVGYQVGMNDELSRDRLIAHPVWTLSFRDGENVVGLVSSQKGPVASYGKVMANRTTLYKYLNPHMN
VVLTDQRQGRPVTKDTNATTPTTEHPGCGVYVVDNVKGSILYEASLPSPGPGMKCNVKATLTENWLAYHYYDPEE
AAVEEARGWRLVTVEFYEGDIDKKTKSSETSSFSEASTQVQIFEDVFVFPQGITAMTMTKTKFGISTKDLIVATN
SNKIQSYPRRLLDPRRPRRKPTNQELEEGLMQYEPVLFDHPKAVLSHEYDVARTQHIITAPSLLESTSLVFATGL
DMFLTRTSPSGTFDLLSETFNKKQLIWTVGGLLVALLVAWPMPHLTAASTSLASAKKVACAPSPVEVVYLNGEVI
EVIELEEEEVIEDNTEDYIDFEGGCYNPNDDDVNSYSDFVREEDIISRESKTKDVNFFFSVGKQIGNARKRQCLT
CRKERREKWIVAETTTLRRHMASTHKSVYYQWALQNNFKSMLPADRKAEKHVKTNKRASQSTLDPYLTLHPPSNR
GAVEYYDAAFTQAALEWIAVTNQPLSALQHPKFREMIEIASRAEEEVVIPSQEETRDALIDLFKKNPTSFRGRLA
KDIARDVGL*
Coding >Agabi119p4|782800
ATGCGGCAGCTGTTCTTTGTTTTCCTGCTCGCCCTACAGTCGTGTCTCGTTCATGCCGTCCACAAGTCCGACGTT
GGCCTCATCGATTGGTACAAACAACTCGTCGGCGTGCCTCTGACCACGACAGCCAATTCACCTACCTTTCACCAT
GTCGGCGGACGAGATATTCTCCTAACAGCAACAATGAGCAACGTGTTGGCAGCGCTCGATGCGGAGGACGGACAA
GTTGCGTGGCGGTACATCTTCGAGGGCGAGGATATGATTGCTGGTTACTATGCTCATGACAATGTTGTCGTAACA
TTATCTGGAACCGGCGGCGAAATCTTGCGGACATTCGACATACAGACGGGCGTTCTCTTACTCGAGAAACAACTC
CACCTCCCGCAACTCGGTCATCGGGCCGAACCTCATACCTTTGGAAAACATGTTGTGTTTGGCGACAACAACAGC
ACGGATATCTACGTTCTGACGAACGGGTACAACTTTGCTCGCATGAATCGCGAAACTGGAGAAACCTATTGGGAG
TTTGCCTCGCCTGATGCCAGCTCATTAGTGATTCATTCAAAGCTTGTCTTAACGCCCTCCGCCCTCTATCTTATT
GGCATTGCCAAGTCATTGCAGTCCTATACCCTCCATGTCACGTCTTTGAATCCAAAGACCGGTGAATTAATCTCT
ACCGCAAACATTCCCTCCAGTATCGAGAACCCAATAAACGGATTTCAAGTACTCTCTAACGGTATTTCGGACAAT
AATCGAATCGTTTGGTTAGAGCATGGCACTCTTAAACACGTCCTTCTCGTTCCCAAATTGACTTCAAAACCGGTT
TCTGTGCAACAAGCAGAATTCGAATCCTTCGTTGATGTTGGTCTTTCAAAGGACGCGCACATAGTTGCTATCAAG
ACCGATGGCGCTGCTCGTGTCATCAAGTTGATTGAGGATGGTATAACGGGAGTATACGACTTTAAGAATGAGGCC
ACCACGAACGAGGAACAACGATTTCCCGTATATTCAGGCAATGTAGAAGAGACCGGGCGCGTTCATGTTGCGAGG
GTCTACTGGAAACAAGATGTCAAGCAAGTCGCGCTGGAAATTTATTCAGGAACGCCAGACTTGAGCTTTAGCTTG
TTCGATTTTGACACTCTCAATAATGGAGTTATCAACTTCGCTGCTTTGAACGCCCGAGGCACTGGTTCAAATGAC
ATTGCTCCTAGGCTCCTCATCTTGACGTATACCGGCAATGTTCAACTGGTTGAAGGCACACAAGTGAAATGGAAT
CGGGAAGAAGCTTTGACCAGTTCTGTTGTTGCCGAATTTGCCGAGCTACCACCACCAAAAGCGGTGGTGGGTGAC
CATGAAGGCGAGTCGTTTGTGAGCCGAGTGATCCGTCACATTGCAGACCTTCAGAAATTACCCGCATATATTCTC
CATTTTCTGAAGCGGTTTGTCATGAATCAATCATCCGTTCTAACCACCAAAAACAACATTCAGTCTGATGAAGCT
GTTCGGGATGAGTTCGGTTTTAGACAAATCATTGTGGTGGCCACTATGTTTGGAAAAGTGTATGGCATTGATTCG
GCAACGGGAAGTGTCGTTTGGATGAGGTTACTTGGTTTAGGATGGGCCGCCAACGGCGGTGCACGTCTTGCCCCT
TTGAAACTCTATACATTCAATGGGGAGGGTGTTGGTGGGGAGGGCAAGGGCGCGAGGTCTGATGTTGTCTTGATT
GTCCAGAGGACAGCGGCTAATACGTTGGTTGATACGGTGTTGTTCCACATCGATGCAGCGACAGGACAGGACCTT
ACAGGTAAAACCGCCGGGAGTGATGTGCTTGAGGGCATAGATATTGTACCTGGAGTTATGGTGGAGTCATATATG
CTACAACTCAAAGGGCAGAAATTGGTGATGCTCCTTGACGAATATCTTCAGACTTATACATACCCCGACACCCCA
GAAGCTTACGACCTGCTAAAAGAGGTTGCTTCCTCATTGTACTTCCCCTTACGCACCAACTCAAAATTGCCCTCT
CCACCTGGTTCTCCCAGGCAACGTCATCTCGTTGGTTACCAGGTTGGTATGAATGACGAGCTAAGCAGAGACCGT
CTGATAGCTCATCCTGTCTGGACATTATCATTCCGAGATGGTGAAAATGTCGTTGGCCTAGTCAGTTCTCAAAAA
GGTCCCGTTGCTAGTTATGGCAAAGTTATGGCAAATCGGACGACGTTGTATAAATACTTGAATCCACATATGAAT
GTGGTTTTGACCGATCAACGACAAGGACGGCCAGTGACAAAGGACACGAATGCGACGACACCTACTACCGAGCAC
CCGGGTTGTGGGGTTTATGTGGTGGATAACGTGAAGGGTTCTATTCTATATGAAGCGTCGTTACCTTCACCGGGT
CCTGGAATGAAGTGCAATGTCAAGGCTACATTGACCGAAAATTGGTTAGCGTATCATTATTATGATCCGGAGGAG
GCTGCTGTTGAGGAAGCGAGAGGTTGGAGATTAGTTACTGTTGAGTTTTATGAGGGTGATATCGATAAAAAGACC
AAGAGTTCCGAAACGTCTAGTTTCTCGGAAGCAAGTACGCAAGTACAAATATTTGAAGATGTTTTTGTATTCCCG
CAAGGAATCACTGCAATGACAATGACTAAGACCAAGTTTGGTATCTCTACAAAAGACTTGATTGTTGCAACGAAC
AGCAATAAGATTCAGTCATACCCTAGAAGACTTCTCGACCCTCGTCGACCACGCCGAAAACCTACAAATCAAGAA
CTCGAAGAGGGATTAATGCAATATGAGCCCGTCTTGTTCGACCATCCCAAAGCCGTCCTTTCACATGAATACGAC
GTAGCGCGTACTCAACATATCATCACAGCTCCCTCACTTCTCGAATCCACCTCCCTCGTGTTCGCAACTGGTTTA
GATATGTTCCTTACACGGACATCACCGTCTGGGACGTTTGATTTGCTGAGTGAGACGTTTAATAAGAAACAGTTG
ATATGGACTGTTGGGGGGCTGTTGGTGGCACTTTTGGTAGCGTGGCCGATGCCACATTTGACTGCCGCGTCAACT
TCGCTAGCGTCTGCGAAGAAAGTCGCTTGCGCACCTTCACCCGTTGAAGTAGTTTATTTGAATGGGGAAGTAATA
GAGGTAATTGAGCTTGAGGAAGAAGAGGTAATTGAAGACAACACTGAAGATTACATAGACTTCGAAGGTGGTTGT
TACAATCCAAATGACGACGATGTAAACTCATATTCGGATTTTGTCCGAGAAGAGGATATAATTTCACGGGAGAGC
AAAACCAAGGATGTGAACTTCTTTTTCTCAGTTGGAAAGCAAATCGGTAATGCCAGAAAGCGACAATGCCTCACT
TGCCGAAAGGAAAGACGTGAAAAATGGATTGTTGCTGAAACGACGACGCTACGACGCCACATGGCGTCCACTCAC
AAGAGCGTATACTACCAATGGGCTCTCCAAAACAACTTTAAGTCCATGTTACCAGCTGACCGGAAGGCTGAGAAG
CATGTAAAGACAAACAAACGTGCATCGCAGAGCACACTCGATCCCTACTTGACGTTACATCCACCTTCTAATCGC
GGCGCCGTTGAATACTATGACGCAGCTTTCACACAGGCCGCGCTCGAGTGGATTGCTGTTACCAATCAGCCTCTC
AGCGCCCTTCAACATCCAAAATTTCGAGAAATGATTGAAATTGCCTCCCGTGCTGAAGAGGAAGTTGTTATTCCT
TCTCAAGAGGAAACTCGCGATGCACTCATCGATCTCTTCAAGAAGAATCCAACTAGCTTCAGAGGTCGTTTGGCG
AAAGATATAGCTCGTGATGTCGGTCTCTAG
Transcript >Agabi119p4|782800
ATGCGGCAGCTGTTCTTTGTTTTCCTGCTCGCCCTACAGTCGTGTCTCGTTCATGCCGTCCACAAGTCCGACGTT
GGCCTCATCGATTGGTACAAACAACTCGTCGGCGTGCCTCTGACCACGACAGCCAATTCACCTACCTTTCACCAT
GTCGGCGGACGAGATATTCTCCTAACAGCAACAATGAGCAACGTGTTGGCAGCGCTCGATGCGGAGGACGGACAA
GTTGCGTGGCGGTACATCTTCGAGGGCGAGGATATGATTGCTGGTTACTATGCTCATGACAATGTTGTCGTAACA
TTATCTGGAACCGGCGGCGAAATCTTGCGGACATTCGACATACAGACGGGCGTTCTCTTACTCGAGAAACAACTC
CACCTCCCGCAACTCGGTCATCGGGCCGAACCTCATACCTTTGGAAAACATGTTGTGTTTGGCGACAACAACAGC
ACGGATATCTACGTTCTGACGAACGGGTACAACTTTGCTCGCATGAATCGCGAAACTGGAGAAACCTATTGGGAG
TTTGCCTCGCCTGATGCCAGCTCATTAGTGATTCATTCAAAGCTTGTCTTAACGCCCTCCGCCCTCTATCTTATT
GGCATTGCCAAGTCATTGCAGTCCTATACCCTCCATGTCACGTCTTTGAATCCAAAGACCGGTGAATTAATCTCT
ACCGCAAACATTCCCTCCAGTATCGAGAACCCAATAAACGGATTTCAAGTACTCTCTAACGGTATTTCGGACAAT
AATCGAATCGTTTGGTTAGAGCATGGCACTCTTAAACACGTCCTTCTCGTTCCCAAATTGACTTCAAAACCGGTT
TCTGTGCAACAAGCAGAATTCGAATCCTTCGTTGATGTTGGTCTTTCAAAGGACGCGCACATAGTTGCTATCAAG
ACCGATGGCGCTGCTCGTGTCATCAAGTTGATTGAGGATGGTATAACGGGAGTATACGACTTTAAGAATGAGGCC
ACCACGAACGAGGAACAACGATTTCCCGTATATTCAGGCAATGTAGAAGAGACCGGGCGCGTTCATGTTGCGAGG
GTCTACTGGAAACAAGATGTCAAGCAAGTCGCGCTGGAAATTTATTCAGGAACGCCAGACTTGAGCTTTAGCTTG
TTCGATTTTGACACTCTCAATAATGGAGTTATCAACTTCGCTGCTTTGAACGCCCGAGGCACTGGTTCAAATGAC
ATTGCTCCTAGGCTCCTCATCTTGACGTATACCGGCAATGTTCAACTGGTTGAAGGCACACAAGTGAAATGGAAT
CGGGAAGAAGCTTTGACCAGTTCTGTTGTTGCCGAATTTGCCGAGCTACCACCACCAAAAGCGGTGGTGGGTGAC
CATGAAGGCGAGTCGTTTGTGAGCCGAGTGATCCGTCACATTGCAGACCTTCAGAAATTACCCGCATATATTCTC
CATTTTCTGAAGCGGTTTGTCATGAATCAATCATCCGTTCTAACCACCAAAAACAACATTCAGTCTGATGAAGCT
GTTCGGGATGAGTTCGGTTTTAGACAAATCATTGTGGTGGCCACTATGTTTGGAAAAGTGTATGGCATTGATTCG
GCAACGGGAAGTGTCGTTTGGATGAGGTTACTTGGTTTAGGATGGGCCGCCAACGGCGGTGCACGTCTTGCCCCT
TTGAAACTCTATACATTCAATGGGGAGGGTGTTGGTGGGGAGGGCAAGGGCGCGAGGTCTGATGTTGTCTTGATT
GTCCAGAGGACAGCGGCTAATACGTTGGTTGATACGGTGTTGTTCCACATCGATGCAGCGACAGGACAGGACCTT
ACAGGTAAAACCGCCGGGAGTGATGTGCTTGAGGGCATAGATATTGTACCTGGAGTTATGGTGGAGTCATATATG
CTACAACTCAAAGGGCAGAAATTGGTGATGCTCCTTGACGAATATCTTCAGACTTATACATACCCCGACACCCCA
GAAGCTTACGACCTGCTAAAAGAGGTTGCTTCCTCATTGTACTTCCCCTTACGCACCAACTCAAAATTGCCCTCT
CCACCTGGTTCTCCCAGGCAACGTCATCTCGTTGGTTACCAGGTTGGTATGAATGACGAGCTAAGCAGAGACCGT
CTGATAGCTCATCCTGTCTGGACATTATCATTCCGAGATGGTGAAAATGTCGTTGGCCTAGTCAGTTCTCAAAAA
GGTCCCGTTGCTAGTTATGGCAAAGTTATGGCAAATCGGACGACGTTGTATAAATACTTGAATCCACATATGAAT
GTGGTTTTGACCGATCAACGACAAGGACGGCCAGTGACAAAGGACACGAATGCGACGACACCTACTACCGAGCAC
CCGGGTTGTGGGGTTTATGTGGTGGATAACGTGAAGGGTTCTATTCTATATGAAGCGTCGTTACCTTCACCGGGT
CCTGGAATGAAGTGCAATGTCAAGGCTACATTGACCGAAAATTGGTTAGCGTATCATTATTATGATCCGGAGGAG
GCTGCTGTTGAGGAAGCGAGAGGTTGGAGATTAGTTACTGTTGAGTTTTATGAGGGTGATATCGATAAAAAGACC
AAGAGTTCCGAAACGTCTAGTTTCTCGGAAGCAAGTACGCAAGTACAAATATTTGAAGATGTTTTTGTATTCCCG
CAAGGAATCACTGCAATGACAATGACTAAGACCAAGTTTGGTATCTCTACAAAAGACTTGATTGTTGCAACGAAC
AGCAATAAGATTCAGTCATACCCTAGAAGACTTCTCGACCCTCGTCGACCACGCCGAAAACCTACAAATCAAGAA
CTCGAAGAGGGATTAATGCAATATGAGCCCGTCTTGTTCGACCATCCCAAAGCCGTCCTTTCACATGAATACGAC
GTAGCGCGTACTCAACATATCATCACAGCTCCCTCACTTCTCGAATCCACCTCCCTCGTGTTCGCAACTGGTTTA
GATATGTTCCTTACACGGACATCACCGTCTGGGACGTTTGATTTGCTGAGTGAGACGTTTAATAAGAAACAGTTG
ATATGGACTGTTGGGGGGCTGTTGGTGGCACTTTTGGTAGCGTGGCCGATGCCACATTTGACTGCCGCGTCAACT
TCGCTAGCGTCTGCGAAGAAAGTCGCTTGCGCACCTTCACCCGTTGAAGTAGTTTATTTGAATGGGGAAGTAATA
GAGGTAATTGAGCTTGAGGAAGAAGAGGTAATTGAAGACAACACTGAAGATTACATAGACTTCGAAGGTGGTTGT
TACAATCCAAATGACGACGATGTAAACTCATATTCGGATTTTGTCCGAGAAGAGGATATAATTTCACGGGAGAGC
AAAACCAAGGATGTGAACTTCTTTTTCTCAGTTGGAAAGCAAATCGGTAATGCCAGAAAGCGACAATGCCTCACT
TGCCGAAAGGAAAGACGTGAAAAATGGATTGTTGCTGAAACGACGACGCTACGACGCCACATGGCGTCCACTCAC
AAGAGCGTATACTACCAATGGGCTCTCCAAAACAACTTTAAGTCCATGTTACCAGCTGACCGGAAGGCTGAGAAG
CATGTAAAGACAAACAAACGTGCATCGCAGAGCACACTCGATCCCTACTTGACGTTACATCCACCTTCTAATCGC
GGCGCCGTTGAATACTATGACGCAGCTTTCACACAGGCCGCGCTCGAGTGGATTGCTGTTACCAATCAGCCTCTC
AGCGCCCTTCAACATCCAAAATTTCGAGAAATGATTGAAATTGCCTCCCGTGCTGAAGAGGAAGTTGTTATTCCT
TCTCAAGAGGAAACTCGCGATGCACTCATCGATCTCTTCAAGAAGAATCCAACTAGCTTCAGAGGTCGTTTGGCG
AAAGATATAGCTCGTGATGTCGGTCTCTAG
Gene >Agabi119p4|782800
ATGCGGCAGCTGTTCTTTGTTTTCCTGCTCGCCCTACAGTCGTGTCTCGTTCATGCCGTCCACAAGTCCGACGTT
GGCCTCATCGATTGGTACAAACAACTCGTCGGCGTGCCTCTGACCACGACAGCCAATTCACCTACCTTTCACCAT
GTCGGCGGACGAGATATTCTCCTAACAGCAACAATGAGCAACGTGTTGGCAGCGCTCGATGCGGAGGACGGACAA
GTTGGTGAGTACGCTGACTTTATCAGGGTGCTGTTGTAACCCGTCCCTTTGTGTAGCGTGGCGGTACATCTTCGA
GGGCGAGGATATGATTGCTGGTTACTATGCTCATGACAATGGTAGGCTCTGCCATTCGTTTCTTCAAGGCACATC
TTATGCTAATTCACTTAGTTGTCGTAACATTATCTGGAACCGGCGGCGAAATCTTGCGGACATTCGACATACAGA
CGGGCGTTCTCTTACTCGAGAAACAACTCCACCTCCCGCAACTCGGTCATCGGGCCGAACCTCATACCTTTGGAA
AACATGTTGTGTTTGGCGACAACAACAGCACGGATATCTACGTTCTGACGAACGGGTACAACTTTGCTCGCATGA
ATCGCGAAACTGGAGAAACCTATTGGGAGTTTGCCTCGCCTGATGCCAGGTTCGCCATCCACGCTGACTGTTTTA
CACTGTGCTGAATGACCCTAGCTCATTAGTGATTCATTCAAAGCTTGTCTTAACGCCCTCCGCCCTCTATCTTAT
TGGCATTGCCAAGTCATTGCAGTCCTATACCCTCCATGTCACGTCTTTGAATCCAAAGACCGGTGAATTAATCTC
TACCGCAAACATTCCCTCCAGTATCGAGAACCCAATAAACGGATTTCAAGTACTCTCTAACGGTATTTCGGACAA
TAATCGAATCGTTTGGTTAGAGCATGGCACTCTTAAACACGTCCTTCTCGTTCCCAAATTGACTTCAAAACCGGT
TTCTGTGCAACAAGCAGAATTCGAATCCTTCGTTGATGTTGGTCTTTCAAAGGACGCGCACATAGTTGCTATCAA
GACCGATGGCGCTGCTCGTGTCATCAAGTTGATTGAGGATGGTATAACGGGAGTATACGACTTTAAGAATGAGGT
GAGGATCGTAAGATTAATCCACACTAGACATTAATTCAATTTTCAGGCCACCACGAACGAGGAACAACGATTTCC
CGTATATTCAGGCAATGTAGAAGAGACCGGGCGCGTTCATGTTGCGAGGGTCTACTGGAAACAAGATGTCAAGGT
AAATAATGATGTTCTAGAGTTGCTTTTCCCATGATTGATTCGCGAGGCAGCAAGTCGCGCTGGAAATTTATTCAG
GAACGCCAGACTTGAGCTTTAGCTTGTTCGATTTTGACACTCTCAATAATGGAGTTATCAACTTCGCTGCTTTGA
ACGCCCGAGGCACTGGTTCAAATGACATTGCTCCTAGGCTCCTCATCTTGACGTATACCGGCAATGTTCAACTGG
TTGAAGGCACACAAGTGAAATGGAATCGGGAAGAAGCTTTGACCAGTTCTGTTGTTGCCGAATTTGCCGAGCTAC
CACCACCAAAAGCGGTGGTGGGTGACCATGAAGGCGAGTCGTTTGTGAGCCGAGTGATCCGTCACATTGCAGACC
TTCAGGTAAGAGACTTTGTCCTTGTCTTAACCTAAATTAAGCTCATTTGCGTATAGAAATTACCCGCATATATTC
TCCATTTTCTGAAGCGGTTTGTCATGAATCAATCATCCGTTCTAACCACCAAAAACAACATTCAGTCTGATGAAG
CTGTTCGGGATGAGTTCGGTTTTAGACAAATCATTGTGGTGGCCACTATGTTTGGAAAAGTGTATGGCATTGATT
CGGCAACGGGAAGTGTCGTTTGGATGAGGTTACTTGGTTTAGGATGGGCCGCCAACGGCGGTGCACGTCTTGCCC
CTTTGAAACTCTATACATTCAATGGGGAGGGTGTTGGTGGGGAGGGCAAGGGCGCGAGGTCTGATGTTGTCTTGA
TTGTCCAGAGGACAGCGGCTAATGTAAGCCCTCAACATGTTTTCATCTAAATTTTCTGATTATTTCACTTAGACG
TTGGTTGATACGGTGTTGTTCCACATCGATGCAGCGACAGGACAGGACCTTACAGGTAAAACCGCCGGGAGTGAT
GTGCTTGAGGGCATAGATATTGTACCTGGAGTTATGGTGGAGTCATATATGCTACAACTCAAAGGGCAGAAATTG
GTGATGCTCCTTGACGAATATCTTCAGGTATGCTGATGGTTTCTGTTGCATCATCACTACGTGTTCTCATGCGAA
TTTCCAGACTTATACATACCCCGACACCCCAGAAGCTTACGACCTGCTAAAAGAGGTTGCTTCCTCATTGTACTT
CCCCTTACGCACCAACTCAAAATTGCCCTCTCCACCTGGTTCTCCCAGGCAACGTCATCTCGTTGGTTACCAGGT
TGGTATGAATGACGAGCTAAGCAGAGACCGTCTGATAGCTCATCCTGTCTGGACATTATCATTCCGAGATGGTGA
AAATGTCGTTGGCCTAGTCAGTTCTCAAAAAGGTCCCGTTGCTAGTTATGGCAAAGTTATGGCAAATCGGACGAC
GTTGTATAAATACTTGAATCCACATATGAATGTGGTTTTGACCGATCAACGACAAGGACGGCCAGTGACAAAGGA
CACGAATGCGACGACACCTACTACCGAGCACCCGGGTTGTGGGGTTTATGTGGTGGATAACGTGAAGGGTTCTAT
TCTATATGAAGCGTCGTTACCTTCACCGGGTCCTGGAATGAAGTGCAATGTCAAGGCTACATTGACCGAAAATTG
GTTAGCGTATCATTATTATGATCCGGAGGAGGCTGCTGTTGAGGAAGCGAGAGGTTGGAGATTAGTTACTGTTGA
GTTTTATGAGGGTGATATCGATAAAAAGACCAAGAGGTACGTCATTTGACAATGCGAATGCAGCTTCTGAGCTGA
CATTTATCGGTAGTTCCGAAACGTCTAGTTTCTCGGAAGCAAGTACGCAAGTACAAATATTTGAAGATGTTTTTG
TATTCCCGCAAGGAATCACTGCAATGACAATGACTAAGACCAAGTTTGGTATCTCTACAAAAGACTTGATTGGTG
ATTTCGTTCATTTGAGCTACTATTTTCCGTTCAATACTGACCTGGGGATTTCTTTAGTTGCAACGAACAGCAATA
AGATTCAGTCATACCCTAGAAGACTTCTCGACCCTCGTCGACCACGCCGAAAACCTACAAATCAAGAACTCGAAG
AGGGATTAATGCAATATGAGCCCGTCTTGTTCGACCATCCCAAAGCCGTCCTTTCACATGAATACGACGTAGCGC
GTACTCAACATATCATCACAGCTCCCTCACTTCTCGAATCCACCTCCCTCGTGTTCGCAACTGGTTTAGATATGT
TCCTTACACGGACATCACCGTCTGGGACGTTTGATTTGCTGAGTGAGACGTTTAATAAGAAACAGTTGATATGGA
CTGTTGGGGGGCTGTTGGTGGCACTTTTGGTAGCGTGGCCGATGGTGAGGGAGAAAAAATTGAATGGGAAATGGT
ATTTCTAGCGTGCTTGTGTATTTATCATCGGCTTTATATAAAAGTACTTAATTGACCAACGGTGCGGTGTGAGGA
CACACAACGTACAACCTGACAGACAGACAATGAGTCCCACCCCGAAACGACAACGGCTTCTCTCACACAAGGCAG
ACAACATGCTGAAGCCGCAACTAGCTCTCACAAGCGATCACGCGGAGATAAAACTAACCCTATCATTTTTAAAAA
CATATTCCCAGCCACATTTGACTGCCGCGTCAACTTCGCTAGCGTCTGCGAAGAAAGTCGCTTGCGCACCTTCAC
CCGTTGAAGTAGTTTATTTGAATGGGGAAGTAATAGAGGTAATTGAGCTTGAGGAAGAAGAGGTAATTGAAGACA
ACACTGAAGATTACATAGACTTCGAAGGTGGTTGTTACAATCGTATGTCATTGCTCAAAACTAACAAAGTGCGCC
CGCATACACCCAGCAAATGACGACGATGTAAACTCATATTCGGATTTTGTCCGAGAAGAGGATATAATTTCACGG
GAGAGCAAAACCAAGGATGTGAACTTCTTTTTCTCAGTTGGAAAGCAAATCGGTAATGCCAGAAAGCGACAATGC
CTCACTTGCCGGTATAAAGAAATACCCCTTATCTTTTTTTTATCTATAGCTGACAGGACACGTCCACAGAAAGGA
AAGACGTGAAAAATGGATTGTTGCTGAAACGACGACGCTACGACGCCACATGGCGTCCACTCACAAGGTCTGTTT
TAATCGTATTTTGATAGGGAAGAAGCTAATCTATCATAGAGCGTATACTACCAATGGGCTCTCCAAAACAACTTT
AAGTCCATGTTACCAGCTGACCGGAAGGCTGAGAAGCATGTAAAGACAAACAAACGTGCATCGCAGAGCACACTC
GATCCCTACTTGACGTTACATCCACCTTCTAATCGCGGCGCCGTTGAATACTATGACGCAGCTTTCACACAGGCC
GCGCTCGAGTGGATTGCTGTTACCAATCAGGTATGTGAATAACTTGATACTTCATTGGTACATGCTTGTATATTT
TATATAGCCTCTCAGCGCCCTTCAACATCCAAAATTTCGAGAAATGATTGAAATTGCCTCCCGTGCTGAAGAGGA
AGTTGTTATTCCTTCTCAAGAGGAAACTCGCGATGTCGGAAAACCAAAACGCGCCTGATCTAGTTACGTTTGACT
GATCTTAAAAATGGCCTGACCCGTTCTGATCCACCCTGATCAGACTGCCTCAGGACTGCCTTATCCTGCCTTATC
CTACTAGATCGGGACGCCTAGGCCTGATAGTGTCTAATCAGGTTAGAACAGGCAAACGTAAAATGATTTAGCATG
ATCAGGCTAATTTCAGTTTTCCGACAGAGGCACTCATCGATCTCTTCAAGAAGAATCCAACTAGCTTCAGAGGTC
GTTTGGCGGTGCGTTCTTATCTGTATAACACGAGCCTGACCTACTCATTGTTTTTCAGAAAGATATAGCTCGTGA
TGTCGGTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail