Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|782150
Gene name
Locationscaffold_13:221928..222475
Strand-
Gene length (bp)547
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07249 Cerato-platanin Cerato-platanin 2.2E-15 33 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1E8D2|AG19_COCIM Heat-stable 19 kDa antigen OS=Coccidioides immitis (strain RS) GN=CSA PE=3 SV=1 7 95 3.0E-13
sp|E9CX44|AG19_COCPS Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CSA PE=1 SV=1 7 95 6.0E-13
sp|P0CW95|AG19_COCP7 Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain C735) GN=CSA PE=1 SV=1 7 95 6.0E-13
sp|D4ALV6|AL15_ARTBC Allergen Asp f 15 homolg OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05304 PE=1 SV=1 17 95 4.0E-12
sp|O60022|AL15_ASPFU Allergen Asp f 15 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G12630 PE=1 SV=1 1 95 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1E8D2|AG19_COCIM Heat-stable 19 kDa antigen OS=Coccidioides immitis (strain RS) GN=CSA PE=3 SV=1 7 95 3.0E-13
sp|E9CX44|AG19_COCPS Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CSA PE=1 SV=1 7 95 6.0E-13
sp|P0CW95|AG19_COCP7 Heat-stable 19 kDa antigen OS=Coccidioides posadasii (strain C735) GN=CSA PE=1 SV=1 7 95 6.0E-13
sp|D4ALV6|AL15_ARTBC Allergen Asp f 15 homolg OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05304 PE=1 SV=1 17 95 4.0E-12
sp|O60022|AL15_ASPFU Allergen Asp f 15 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G12630 PE=1 SV=1 1 95 2.0E-08
sp|O74238|SNP1_PHANO Protein SnodProt1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13722 PE=2 SV=1 22 95 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|782150
MQFTSTFTLLASTLTAIPAMGLALSSRSPTVVFNYDTRYDEPNVSLSTTSCSADAGNLEGHKTFGSIPNFPHIVG
SFVAGGFNSTECGACYNLTYTPTDGSEPTVIPFTVINDDQKEFPWRCSYLLRGSSNPLLWLLKNICLFISDL*
Coding >Agabi119p4|782150
ATGCAATTCACTTCTACCTTCACTCTTCTCGCCTCTACTCTCACTGCCATCCCTGCTATGGGTTTGGCTCTGTCT
TCCAGGAGTCCTACTGTAGTGTTCAACTATGACACTCGCTACGACGAGCCTAATGTGTCGCTCAGCACTACTTCG
TGCTCCGCAGATGCGGGTAATCTCGAGGGACACAAGACCTTTGGGTCAATCCCTAACTTCCCCCACATTGTTGGG
TCTTTTGTTGCCGGGGGTTTCAACTCGACTGAATGTGGAGCTTGCTACAACCTCACGTACACCCCCACGGATGGC
AGTGAACCGACTGTCATTCCCTTCACGGTTATCAACGATGACCAGAAAGAATTTCCCTGGCGATGTTCCTATCTA
TTACGAGGAAGTTCCAATCCACTTCTGTGGCTTCTAAAGAATATCTGTCTCTTTATTTCTGACCTGTGA
Transcript >Agabi119p4|782150
ATGCAATTCACTTCTACCTTCACTCTTCTCGCCTCTACTCTCACTGCCATCCCTGCTATGGGTTTGGCTCTGTCT
TCCAGGAGTCCTACTGTAGTGTTCAACTATGACACTCGCTACGACGAGCCTAATGTGTCGCTCAGCACTACTTCG
TGCTCCGCAGATGCGGGTAATCTCGAGGGACACAAGACCTTTGGGTCAATCCCTAACTTCCCCCACATTGTTGGG
TCTTTTGTTGCCGGGGGTTTCAACTCGACTGAATGTGGAGCTTGCTACAACCTCACGTACACCCCCACGGATGGC
AGTGAACCGACTGTCATTCCCTTCACGGTTATCAACGATGACCAGAAAGAATTTCCCTGGCGATGTTCCTATCTA
TTACGAGGAAGTTCCAATCCACTTCTGTGGCTTCTAAAGAATATCTGTCTCTTTATTTCTGACCTGTGA
Gene >Agabi119p4|782150
ATGCAATTCACTTCTACCTTCACTCTTCTCGCCTCTACTCTCACTGCCATCCCTGCTATGGGTTTGGCTCTGTCT
TCCAGGAGTCCTACTGTAGTGTTCAACTATGACACTCGCTACGACGAGCCTAATGTGTCGCTCAGCACTACTTCG
TGCTCCGCAGATGCGGGTAATCTCGAGGGACACAAGACCTTTGGGTCAATCCCTAACTTCCCCCACATTGTTGGG
TCTTTTGTTGCCGGGGGTTTCAACTCGACTGAATGTGGAGCTTGCTACAACCTCACGTACACCCCCACGGATGGC
AGTGAACCGACTGTCATTCCCTTCACGGTTATCAACGATGACCAGAAAGGTTTCACGTCCAGTGTTCAGGGCTTG
AAGGATTTGACGGGATTTGATATCGAGAATTTCCCTGGCGATGTTCCTATCTATTACGAGGAAGTTCCAATCCAC
TTCTGTGGCTTCTAAAGGTAAAACATCATTCACATTTATTGGAAACTAATAACTGATGTTTCTTTAGAATATCTG
TCTCTTTATTTCTGACCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail