Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|782100
Gene name
Locationscaffold_13:208940..212830
Strand-
Gene length (bp)3890
Transcript length (bp)2619
Coding sequence length (bp)2619
Protein length (aa) 873

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00667 FAD_binding_1 FAD binding domain 3.0E-37 197 407
PF00258 Flavodoxin_1 Flavodoxin 9.2E-29 8 145
PF00849 PseudoU_synth_2 RNA pseudouridylate synthase 1.7E-23 617 770
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 4.5E-10 439 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 7 571 7.0E-131
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 7 571 7.0E-131
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 1 568 1.0E-126
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 1 571 2.0E-120
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 1 574 5.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP12|NDOR1_CRYNJ NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TAH18 PE=3 SV=1 7 571 7.0E-131
sp|P0CP13|NDOR1_CRYNB NADPH-dependent diflavin oxidoreductase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TAH18 PE=3 SV=1 7 571 7.0E-131
sp|Q9UHB4|NDOR1_HUMAN NADPH-dependent diflavin oxidoreductase 1 OS=Homo sapiens GN=NDOR1 PE=1 SV=1 1 568 1.0E-126
sp|Q6PFP6|NDOR1_DANRE NADPH-dependent diflavin oxidoreductase 1 OS=Danio rerio GN=ndor1 PE=2 SV=1 1 571 2.0E-120
sp|O94613|NDOR1_SCHPO NADPH-dependent diflavin oxidoreductase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tah18 PE=3 SV=2 1 574 5.0E-120
sp|Q6NRG5|NDOR1_XENLA NADPH-dependent diflavin oxidoreductase 1 OS=Xenopus laevis GN=ndor1 PE=2 SV=1 1 571 5.0E-120
sp|Q1JPJ0|NDOR1_BOVIN NADPH-dependent diflavin oxidoreductase 1 OS=Bos taurus GN=NDOR1 PE=2 SV=2 1 568 9.0E-117
sp|A2AI05|NDOR1_MOUSE NADPH-dependent diflavin oxidoreductase 1 OS=Mus musculus GN=Ndor1 PE=2 SV=1 5 568 9.0E-114
sp|Q4P3D8|NDOR1_USTMA NADPH-dependent diflavin oxidoreductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TAH18 PE=3 SV=2 4 571 1.0E-112
sp|Q4WU59|NDOR1_ASPFU NADPH-dependent diflavin oxidoreductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tah18 PE=3 SV=1 4 571 1.0E-110
sp|Q5BB41|NDOR1_EMENI NADPH-dependent diflavin oxidoreductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tah18 PE=3 SV=3 4 571 3.0E-109
sp|Q5AD27|NDOR1_CANAL NADPH-dependent diflavin oxidoreductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAH18 PE=3 SV=1 6 571 2.0E-102
sp|Q6BR77|NDOR1_DEBHA NADPH-dependent diflavin oxidoreductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TAH18 PE=3 SV=2 8 571 1.0E-100
sp|Q54JL0|NDOR1_DICDI NADPH-dependent diflavin oxidoreductase 1 OS=Dictyostelium discoideum GN=redC PE=2 SV=1 4 554 3.0E-100
sp|Q6CCH0|NDOR1_YARLI NADPH-dependent diflavin oxidoreductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAH18 PE=3 SV=1 4 571 1.0E-98
sp|Q6NPS8|NDOR1_ARATH NADPH-dependent diflavin oxidoreductase 1 OS=Arabidopsis thaliana GN=ATR3 PE=1 SV=1 3 571 6.0E-96
sp|Q4HZQ1|NDOR1_GIBZE NADPH-dependent diflavin oxidoreductase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TAH18 PE=3 SV=2 3 572 8.0E-94
sp|Q6FRH1|NDOR1_CANGA NADPH-dependent diflavin oxidoreductase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TAH18 PE=3 SV=1 1 571 1.0E-86
sp|Q75B78|NDOR1_ASHGO NADPH-dependent diflavin oxidoreductase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TAH18 PE=3 SV=1 1 571 6.0E-86
sp|Q12181|NDOR1_YEAST NADPH-dependent diflavin oxidoreductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAH18 PE=1 SV=1 4 571 7.0E-79
sp|Q6CVG8|NDOR1_KLULA NADPH-dependent diflavin oxidoreductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TAH18 PE=3 SV=1 1 571 2.0E-77
sp|Q27597|NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster GN=Cpr PE=2 SV=2 4 571 3.0E-70
sp|Q07994|NCPR_MUSDO NADPH--cytochrome P450 reductase OS=Musca domestica PE=2 SV=1 4 571 1.0E-68
sp|Q55CT1|NCPR_DICDI NADPH--cytochrome P450 reductase OS=Dictyostelium discoideum GN=redB PE=2 SV=1 8 572 3.0E-60
sp|P37039|NCPR_CAVPO NADPH--cytochrome P450 reductase OS=Cavia porcellus GN=Por PE=2 SV=2 4 574 2.0E-59
sp|P04175|NCPR_PIG NADPH--cytochrome P450 reductase OS=Sus scrofa GN=POR PE=1 SV=2 4 574 3.0E-59
sp|P37040|NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus GN=Por PE=1 SV=2 4 574 2.0E-57
sp|Q3SYT8|NCPR_BOVIN NADPH--cytochrome P450 reductase OS=Bos taurus GN=POR PE=2 SV=3 4 574 3.0E-57
sp|P00388|NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus GN=Por PE=1 SV=3 4 574 4.0E-57
sp|Q9KUX4|CYSJ_VIBCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysJ PE=3 SV=1 5 568 5.0E-57
sp|Q8DCK2|CYSJ_VIBVU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain CMCP6) GN=cysJ PE=3 SV=1 2 571 6.0E-57
sp|A5F3I4|CYSJ_VIBC3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysJ PE=3 SV=1 5 568 1.0E-56
sp|Q7MHA5|CYSJ_VIBVY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio vulnificus (strain YJ016) GN=cysJ PE=3 SV=2 2 571 2.0E-56
sp|P00389|NCPR_RABIT NADPH--cytochrome P450 reductase OS=Oryctolagus cuniculus GN=POR PE=1 SV=1 4 574 2.0E-56
sp|P16435|NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens GN=POR PE=1 SV=2 4 574 4.0E-55
sp|Q87L90|CYSJ_VIBPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysJ PE=3 SV=1 5 571 3.0E-54
sp|A7MJ63|CYSJ_CROS8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysJ PE=3 SV=1 2 574 7.0E-53
sp|Q6LM58|CYSJ_PHOPR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photobacterium profundum GN=cysJ PE=3 SV=1 2 568 9.0E-52
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 6 568 3.0E-50
sp|Q9SB48|NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana GN=ATR1 PE=1 SV=1 5 571 6.0E-50
sp|Q9HDG2|NCPR_PHACH NADPH--cytochrome P450 reductase OS=Phanerochaete chrysosporium GN=CPR PE=2 SV=1 3 561 1.0E-49
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 6 568 3.0E-49
sp|O32214|CYSJ_BACSU Sulfite reductase [NADPH] flavoprotein alpha-component OS=Bacillus subtilis (strain 168) GN=cysJ PE=1 SV=1 4 571 3.0E-48
sp|Q5E841|CYSJ_VIBF1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysJ PE=3 SV=1 2 568 3.0E-48
sp|Q6D1A1|CYSJ_PECAS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysJ PE=3 SV=1 1 574 4.0E-48
sp|Q9SUM3|NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana GN=ATR2 PE=1 SV=1 4 571 5.0E-48
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 5 567 9.0E-48
sp|P19618|NCPR_SALTR NADPH--cytochrome P450 reductase (Fragments) OS=Salmo trutta GN=por PE=1 SV=1 4 574 1.0E-47
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 6 574 2.0E-47
sp|P37201|NCPR_CANTR NADPH--cytochrome P450 reductase OS=Candida tropicalis GN=NCP1 PE=3 SV=1 4 574 6.0E-47
sp|A9N2E6|CYSJ_SALPB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysJ PE=3 SV=1 8 574 1.0E-46
sp|P38039|CYSJ_SALTY Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysJ PE=3 SV=2 1 574 1.0E-46
sp|Q83QD9|CYSJ_SHIFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri GN=cysJ PE=3 SV=3 6 574 2.0E-46
sp|Q0T1I8|CYSJ_SHIF8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella flexneri serotype 5b (strain 8401) GN=cysJ PE=3 SV=1 6 574 2.0E-46
sp|A8G9X6|CYSJ_SERP5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Serratia proteamaculans (strain 568) GN=cysJ PE=3 SV=1 8 574 2.0E-46
sp|A8A3P5|CYSJ_ECOHS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O9:H4 (strain HS) GN=cysJ PE=3 SV=1 6 574 2.0E-46
sp|Q8X7U1|CYSJ_ECO57 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O157:H7 GN=cysJ PE=3 SV=3 6 574 2.0E-46
sp|Q1R7T4|CYSJ_ECOUT Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain UTI89 / UPEC) GN=cysJ PE=3 SV=1 6 574 2.0E-46
sp|Q0TEA2|CYSJ_ECOL5 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysJ PE=3 SV=1 6 574 2.0E-46
sp|A1AEV0|CYSJ_ECOK1 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O1:K1 / APEC GN=cysJ PE=3 SV=1 6 574 2.0E-46
sp|Q8FEI7|CYSJ_ECOL6 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysJ PE=3 SV=3 6 574 2.0E-46
sp|Q3YY94|CYSJ_SHISS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella sonnei (strain Ss046) GN=cysJ PE=3 SV=1 6 574 3.0E-46
sp|P38038|CYSJ_ECOLI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain K12) GN=cysJ PE=1 SV=4 6 574 3.0E-46
sp|B1IU77|CYSJ_ECOLC Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysJ PE=3 SV=1 6 574 3.0E-46
sp|A7ZQK7|CYSJ_ECO24 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysJ PE=3 SV=1 6 574 3.0E-46
sp|Q8Z458|CYSJ_SALTI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella typhi GN=cysJ PE=3 SV=3 8 574 4.0E-46
sp|A6TD49|CYSJ_KLEP7 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysJ PE=3 SV=1 6 574 5.0E-46
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 5 567 6.0E-46
sp|Q31XM4|CYSJ_SHIBS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella boydii serotype 4 (strain Sb227) GN=cysJ PE=3 SV=1 6 574 7.0E-46
sp|A9MF16|CYSJ_SALAR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysJ PE=3 SV=1 2 573 9.0E-46
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 5 567 1.0E-45
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 5 567 2.0E-45
sp|Q0HFL6|CYSJ_SHESM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-4) GN=cysJ PE=3 SV=1 8 571 4.0E-45
sp|Q8K9D3|CYSJ_BUCAP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysJ PE=3 SV=1 3 573 5.0E-45
sp|Q9JUD8|CYSJ_NEIMA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysJ PE=3 SV=1 8 569 7.0E-45
sp|Q57KH7|CYSJ_SALCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella choleraesuis (strain SC-B67) GN=cysJ PE=3 SV=3 1 574 1.0E-44
sp|Q05001|NCPR_CATRO NADPH--cytochrome P450 reductase OS=Catharanthus roseus GN=CPR PE=2 SV=1 3 573 1.0E-44
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 6 571 2.0E-44
sp|Q0HYB4|CYSJ_SHESR Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain MR-7) GN=cysJ PE=3 SV=1 8 571 2.0E-44
sp|Q54B10|REDA_DICDI NADPH oxidoreductase A OS=Dictyostelium discoideum GN=redA PE=2 SV=1 6 565 3.0E-44
sp|Q8EAZ9|CYSJ_SHEON Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella oneidensis (strain MR-1) GN=cysJ PE=3 SV=1 8 571 7.0E-44
sp|A0KTH4|CYSJ_SHESA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shewanella sp. (strain ANA-3) GN=cysJ PE=3 SV=1 8 571 1.0E-43
sp|A1KU06|CYSJ_NEIMF Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=cysJ PE=3 SV=1 8 569 2.0E-43
sp|Q9JS45|CYSJ_NEIMB Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysJ1 PE=3 SV=1 8 569 2.0E-43
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 4 568 2.0E-43
sp|P50126|NCPR_CANMA NADPH--cytochrome P450 reductase OS=Candida maltosa GN=NCP1 PE=2 SV=1 4 574 3.0E-43
sp|A8ANX1|CYSJ_CITK8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysJ PE=3 SV=1 6 574 1.0E-42
sp|A9LZ73|CYSJ_NEIM0 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Neisseria meningitidis serogroup C (strain 053442) GN=cysJ PE=3 SV=1 8 569 2.0E-42
sp|Q968X7|PNO_CRYPV Pyruvate dehydrogenase [NADP(+)] OS=Cryptosporidium parvum GN=PFOR PE=2 SV=1 3 573 2.0E-42
sp|A4TPY5|CYSJ_YERPP Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis (strain Pestoides F) GN=cysJ PE=3 SV=1 8 568 3.0E-42
sp|Q1CLS8|CYSJ_YERPN Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysJ PE=3 SV=1 8 568 3.0E-42
sp|P37116|NCPR_VIGRR NADPH--cytochrome P450 reductase OS=Vigna radiata var. radiata PE=1 SV=1 5 556 4.0E-42
sp|A7FLZ0|CYSJ_YERP3 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysJ PE=3 SV=1 8 568 4.0E-42
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 6 571 5.0E-42
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 5 567 5.0E-42
sp|A1JJS2|CYSJ_YERE8 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysJ PE=3 SV=1 6 568 6.0E-42
sp|Q5PEH7|CYSJ_SALPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysJ PE=3 SV=3 8 574 6.0E-42
sp|A2QS05|NCPR_ASPNC NADPH--cytochrome P450 reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cprA PE=3 SV=1 4 571 8.0E-42
sp|Q4WM67|NCPR_ASPFU NADPH--cytochrome P450 reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cprA PE=1 SV=1 4 571 1.0E-41
sp|Q66ED4|CYSJ_YERPS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysJ PE=3 SV=1 8 568 2.0E-41
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 6 574 2.0E-41
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 5 567 2.0E-41
sp|Q00141|NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger GN=cprA PE=1 SV=2 4 571 3.0E-41
sp|Q2NVN4|CYSJ_SODGM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Sodalis glossinidius (strain morsitans) GN=cysJ PE=3 SV=1 6 574 3.0E-41
sp|Q8ZBN6|CYSJ_YERPE Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis GN=cysJ PE=3 SV=1 8 568 7.0E-41
sp|Q1C3Z0|CYSJ_YERPA Sulfite reductase [NADPH] flavoprotein alpha-component OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysJ PE=3 SV=1 8 568 7.0E-41
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 5 567 1.0E-40
sp|Q2UHA7|NCPR_ASPOR NADPH--cytochrome P450 reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cprA PE=3 SV=1 4 571 2.0E-40
sp|Q0CMM0|NCPR_ASPTN NADPH--cytochrome P450 reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cprA PE=3 SV=1 4 571 2.0E-40
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 89 568 4.0E-40
sp|Q94IN5|PNO_EUGGR Pyruvate dehydrogenase [NADP(+)], mitochondrial OS=Euglena gracilis GN=PNO PE=1 SV=1 6 571 9.0E-40
sp|Q65T53|CYSJ_MANSM Sulfite reductase [NADPH] flavoprotein alpha-component OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysJ PE=3 SV=1 8 571 3.0E-39
sp|A4WDW1|CYSJ_ENT38 Sulfite reductase [NADPH] flavoprotein alpha-component OS=Enterobacter sp. (strain 638) GN=cysJ PE=3 SV=1 6 574 4.0E-39
sp|Q8C1A3|MTRR_MOUSE Methionine synthase reductase OS=Mus musculus GN=Mtrr PE=1 SV=2 115 566 9.0E-39
sp|Q5BFT5|NCPR_EMENI NADPH--cytochrome P450 reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cprA PE=3 SV=1 4 571 2.0E-38
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 230 566 2.0E-38
sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 8 568 7.0E-38
sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 8 571 1.0E-37
sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 89 568 3.0E-37
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 3 573 8.0E-37
sp|P36587|NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr1 PE=2 SV=1 8 553 2.0E-36
sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 8 568 2.0E-36
sp|P16603|NCPR_YEAST NADPH--cytochrome P450 reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCP1 PE=1 SV=3 4 555 2.0E-35
sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 89 568 6.0E-35
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 218 566 6.0E-35
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 8 568 2.0E-34
sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 8 571 2.0E-34
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 8 568 3.0E-34
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 225 566 3.0E-34
sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 8 557 4.0E-34
sp|Q09878|MET10_SCHPO Probable sulfite reductase [NADPH] flavoprotein component OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.01c PE=3 SV=2 202 569 5.0E-34
sp|P29474|NOS3_HUMAN Nitric oxide synthase, endothelial OS=Homo sapiens GN=NOS3 PE=1 SV=3 8 557 8.0E-34
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 8 568 1.0E-33
sp|O19114|NOS2_RABIT Nitric oxide synthase, inducible (Fragment) OS=Oryctolagus cuniculus GN=NOS2 PE=2 SV=1 102 567 6.0E-33
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 6 569 1.0E-32
sp|Q28969|NOS3_PIG Nitric oxide synthase, endothelial OS=Sus scrofa GN=NOS3 PE=1 SV=4 1 557 5.0E-32
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 87 536 1.0E-31
sp|P39692|MET10_YEAST Sulfite reductase [NADPH] flavoprotein component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET10 PE=1 SV=2 159 557 3.0E-31
sp|Q9TUX8|NOS3_CANLF Nitric oxide synthase, endothelial OS=Canis lupus familiaris GN=NOS3 PE=2 SV=1 8 557 2.0E-29
sp|O61309|NOS_LYMST Nitric oxide synthase OS=Lymnaea stagnalis GN=NOS PE=2 SV=1 8 465 8.0E-27
sp|Q9US28|YKA1_SCHPO Uncharacterized FAD-binding protein C1783.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1783.01 PE=3 SV=1 297 566 2.0E-20
sp|Q17574|MTRR_CAEEL Putative methionine synthase reductase OS=Caenorhabditis elegans GN=tag-165 PE=3 SV=1 225 566 2.0E-17
sp|Q4JIJ2|MTRR_BOVIN Methionine synthase reductase OS=Bos taurus GN=MTRR PE=2 SV=1 4 149 4.0E-16
sp|P52674|CYSJ_THIRO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Thiocapsa roseopersicina GN=cysJ PE=3 SV=1 5 232 9.0E-16
sp|Q68XB2|RLUC_RICTY Ribosomal large subunit pseudouridine synthase C OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rluC PE=3 SV=1 602 812 1.0E-15
sp|P70870|RLUD_BORBU Ribosomal large subunit pseudouridine synthase D OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rluD PE=3 SV=2 610 813 2.0E-15
sp|Q9UBK8|MTRR_HUMAN Methionine synthase reductase OS=Homo sapiens GN=MTRR PE=1 SV=3 4 149 3.0E-15
sp|Q8C1A3|MTRR_MOUSE Methionine synthase reductase OS=Mus musculus GN=Mtrr PE=1 SV=2 4 186 4.0E-15
sp|Q09744|YB63_SCHPO Uncharacterized FAD-binding protein C12C2.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.03c PE=3 SV=1 155 560 4.0E-15
sp|Q498R1|MTRR_RAT Methionine synthase reductase OS=Rattus norvegicus GN=Mtrr PE=2 SV=2 4 149 5.0E-15
sp|Q45826|Y901_CHLAA Uncharacterized RNA pseudouridine synthase Caur_0901 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_0901 PE=3 SV=2 610 818 7.0E-15
sp|O66114|Y505_ZYMMO Uncharacterized RNA pseudouridine synthase ZMO0505 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO0505 PE=3 SV=2 606 817 1.0E-14
sp|Q1RJX7|RLUC_RICBR Ribosomal large subunit pseudouridine synthase C OS=Rickettsia bellii (strain RML369-C) GN=rluC PE=3 SV=1 599 819 2.0E-14
sp|Q9ZDR7|RLUC_RICPR Ribosomal large subunit pseudouridine synthase C OS=Rickettsia prowazekii (strain Madrid E) GN=rluC PE=3 SV=1 602 812 2.0E-14
sp|O67638|Y1758_AQUAE Uncharacterized RNA pseudouridine synthase aq_1758 OS=Aquifex aeolicus (strain VF5) GN=aq_1758 PE=3 SV=1 610 805 2.0E-14
sp|Q4UKQ3|RLUC_RICFE Ribosomal large subunit pseudouridine synthase C OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rluC PE=3 SV=1 602 812 3.0E-14
sp|Q9LT72|PUS4_ARATH RNA pseudouridine synthase 4, mitochondrial OS=Arabidopsis thaliana GN=At3g19440 PE=2 SV=1 601 783 5.0E-14
sp|P54604|YHCT_BACSU Uncharacterized RNA pseudouridine synthase YhcT OS=Bacillus subtilis (strain 168) GN=yhcT PE=3 SV=2 604 783 6.0E-14
sp|Q92091|NOS2_ONCMY Nitric oxide synthase, inducible (Fragment) OS=Oncorhynchus mykiss GN=nos2 PE=2 SV=1 5 267 7.0E-14
sp|P74346|Y1629_SYNY3 Uncharacterized RNA pseudouridine synthase slr1629 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1629 PE=3 SV=1 610 812 8.0E-14
sp|Q1K9C2|MET5_SCHPO Sulfite reductase [NADPH] subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir1 PE=3 SV=1 6 149 8.0E-14
sp|Q92IS6|RLUC_RICCN Ribosomal large subunit pseudouridine synthase C OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rluC PE=3 SV=1 602 812 2.0E-13
sp|Q89AH2|RLUC_BUCBP Ribosomal large subunit pseudouridine synthase C OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rluC PE=3 SV=1 610 828 3.0E-13
sp|P47169|MET5_YEAST Sulfite reductase [NADPH] subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET5 PE=1 SV=1 6 149 7.0E-13
sp|Q28C59|RUSD4_XENTR RNA pseudouridylate synthase domain-containing protein 4 OS=Xenopus tropicalis GN=rpusd4 PE=2 SV=1 604 822 8.0E-13
sp|O25114|Y347_HELPY Uncharacterized RNA pseudouridine synthase HP_0347 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0347 PE=1 SV=1 659 813 7.0E-12
sp|Q8DBG5|TRUC_VIBVU tRNA pseudouridine synthase C OS=Vibrio vulnificus (strain CMCP6) GN=truC PE=3 SV=1 610 810 8.0E-12
sp|P47451|Y209_MYCGE Uncharacterized RNA pseudouridine synthase MG209 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG209 PE=3 SV=1 610 785 1.0E-11
sp|Q8XYX8|RLUD_RALSO Ribosomal large subunit pseudouridine synthase D OS=Ralstonia solanacearum (strain GMI1000) GN=rluD PE=3 SV=1 548 812 1.0E-11
sp|Q44549|FENR_ANAVT Ferredoxin--NADP reductase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=petH PE=3 SV=1 368 557 1.0E-11
sp|P58558|FENR_NOSS1 Ferredoxin--NADP reductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=petH PE=3 SV=1 368 557 2.0E-11
sp|P59840|TRUC_HAEDU tRNA pseudouridine synthase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=truC PE=3 SV=1 610 789 2.0E-11
sp|Q87MD4|TRUC_VIBPA tRNA pseudouridine synthase C OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=truC PE=3 SV=1 606 810 2.0E-11
sp|Q8ZH72|TRUC_YERPE tRNA pseudouridine synthase C OS=Yersinia pestis GN=truC PE=3 SV=1 610 812 2.0E-11
sp|Q55318|FENR_SYNY3 Ferredoxin--NADP reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=petH PE=1 SV=2 368 557 3.0E-11
sp|Q47417|TRUC_PECCC tRNA pseudouridine synthase C OS=Pectobacterium carotovorum subsp. carotovorum GN=truC PE=3 SV=1 610 812 3.0E-11
sp|P21890|FENR_NOSSO Ferredoxin--NADP reductase OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=petH PE=1 SV=2 368 557 4.0E-11
sp|P53991|FENR_CHLRE Ferredoxin--NADP reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PETH PE=1 SV=1 368 578 6.0E-11
sp|Q87N15|RLUC_VIBPA Ribosomal large subunit pseudouridine synthase C OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rluC PE=3 SV=1 594 783 7.0E-11
sp|Q17574|MTRR_CAEEL Putative methionine synthase reductase OS=Caenorhabditis elegans GN=tag-165 PE=3 SV=1 6 162 8.0E-11
sp|P75230|Y548_MYCPN Uncharacterized RNA pseudouridine synthase MG370 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_548 PE=3 SV=1 610 785 9.0E-11
sp|Q9KP71|RLUA_VIBCH Ribosomal large subunit pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rluA PE=3 SV=1 610 806 1.0E-10
sp|Q9ZMA1|Y347_HELPJ Uncharacterized RNA pseudouridine synthase jhp_0321 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0321 PE=3 SV=1 659 813 1.0E-10
sp|P47610|Y370_MYCGE Uncharacterized RNA pseudouridine synthase MG370 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG370 PE=3 SV=1 610 785 2.0E-10
sp|Q8ZIK1|RLUA_YERPE Ribosomal large subunit pseudouridine synthase A OS=Yersinia pestis GN=rluA PE=3 SV=1 610 812 2.0E-10
sp|Q9KU20|RLUD_VIBCH Ribosomal large subunit pseudouridine synthase D OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rluD PE=3 SV=1 610 783 2.0E-10
sp|Q8D8G1|RLUC_VIBVU Ribosomal large subunit pseudouridine synthase C OS=Vibrio vulnificus (strain CMCP6) GN=rluC PE=3 SV=1 596 783 2.0E-10
sp|Q8FL93|RLUA_ECOL6 Ribosomal large subunit pseudouridine synthase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rluA PE=3 SV=3 610 812 3.0E-10
sp|P44782|RLUA_HAEIN Ribosomal large subunit pseudouridine synthase A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rluA PE=3 SV=1 598 812 3.0E-10
sp|P0AA38|RLUA_SHIFL Ribosomal large subunit pseudouridine synthase A OS=Shigella flexneri GN=rluA PE=3 SV=2 610 812 3.0E-10
sp|P0AA37|RLUA_ECOLI Ribosomal large subunit pseudouridine synthase A OS=Escherichia coli (strain K12) GN=rluA PE=1 SV=2 610 812 3.0E-10
sp|Q9CNF3|TRUC_PASMU tRNA pseudouridine synthase C OS=Pasteurella multocida (strain Pm70) GN=truC PE=3 SV=1 610 806 3.0E-10
sp|Q9CK02|RLUA_PASMU Ribosomal large subunit pseudouridine synthase A OS=Pasteurella multocida (strain Pm70) GN=rluA PE=3 SV=1 610 822 4.0E-10
sp|P75485|Y292_MYCPN Uncharacterized RNA pseudouridine synthase MG209 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_292 PE=3 SV=1 610 785 4.0E-10
sp|Q8Z9J5|RLUA_SALTI Ribosomal large subunit pseudouridine synthase A OS=Salmonella typhi GN=rluA PE=3 SV=3 610 786 5.0E-10
sp|Q8ZRV9|RLUA_SALTY Ribosomal large subunit pseudouridine synthase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rluA PE=3 SV=3 610 786 8.0E-10
sp|P44197|TRUC_HAEIN tRNA pseudouridine synthase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=truC PE=3 SV=2 610 812 9.0E-10
sp|Q9CM51|RLUC_PASMU Ribosomal large subunit pseudouridine synthase C OS=Pasteurella multocida (strain Pm70) GN=rluC PE=3 SV=1 606 823 9.0E-10
sp|P52674|CYSJ_THIRO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Thiocapsa roseopersicina GN=cysJ PE=3 SV=1 426 558 1.0E-09
sp|Q8XA10|RLUA_ECO57 Ribosomal large subunit pseudouridine synthase A OS=Escherichia coli O157:H7 GN=rluA PE=3 SV=3 610 812 1.0E-09
sp|Q93RE3|FENR_THEEB Ferredoxin--NADP reductase OS=Thermosynechococcus elongatus (strain BP-1) GN=petH PE=3 SV=1 368 570 1.0E-09
sp|P50513|RLUD_ZYMMO Ribosomal large subunit pseudouridine synthase D OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rluD PE=3 SV=2 610 783 1.0E-09
sp|Q8PHN2|RLUD_XANAC Ribosomal large subunit pseudouridine synthase D OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rluD PE=3 SV=1 610 806 1.0E-09
sp|P33640|RLUD_PSEAE Ribosomal large subunit pseudouridine synthase D OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rluD PE=3 SV=2 606 813 1.0E-09
sp|O04397|FENR2_TOBAC Ferredoxin--NADP reductase, root-type isozyme, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 400 557 2.0E-09
sp|Q9JVB6|RLUD_NEIMA Ribosomal large subunit pseudouridine synthase D OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rluD PE=3 SV=1 610 812 2.0E-09
sp|Q0J4D4|PUS3_ORYSJ RNA pseudouridine synthase 3, mitochondrial OS=Oryza sativa subsp. japonica GN=Os08g0520100 PE=2 SV=1 604 783 2.0E-09
sp|Q4QQT0|RUSD4_RAT RNA pseudouridylate synthase domain-containing protein 4 OS=Rattus norvegicus GN=Rpusd4 PE=2 SV=1 594 783 2.0E-09
sp|Q45480|YLYB_BACSU Uncharacterized RNA pseudouridine synthase YlyB OS=Bacillus subtilis (strain 168) GN=ylyB PE=3 SV=3 610 783 2.0E-09
sp|P59835|RLUC_HAEDU Ribosomal large subunit pseudouridine synthase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rluC PE=3 SV=1 606 813 2.0E-09
sp|Q9KQH0|RLUC_VIBCH Ribosomal large subunit pseudouridine synthase C OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rluC PE=3 SV=1 606 783 2.0E-09
sp|Q8X9F0|RLUD_ECO57 Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli O157:H7 GN=rluD PE=3 SV=3 610 783 2.0E-09
sp|Q8W493|FNRL2_ARATH Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic OS=Arabidopsis thaliana GN=LFNR2 PE=1 SV=1 368 557 2.0E-09
sp|P59838|RLUD_BLOFL Ribosomal large subunit pseudouridine synthase D OS=Blochmannia floridanus GN=rluD PE=3 SV=1 610 784 2.0E-09
sp|P65835|RLUD_SHIFL Ribosomal large subunit pseudouridine synthase D OS=Shigella flexneri GN=rluD PE=3 SV=2 610 783 2.0E-09
sp|P65834|RLUD_ECOL6 Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rluD PE=3 SV=2 610 783 2.0E-09
sp|Q8ZBV7|RLUD_YERPE Ribosomal large subunit pseudouridine synthase D OS=Yersinia pestis GN=rluD PE=3 SV=1 610 783 3.0E-09
sp|Q8ZMD5|TRUC_SALTY tRNA pseudouridine synthase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=truC PE=3 SV=1 610 780 3.0E-09
sp|Q9KTL4|TRUC_VIBCH tRNA pseudouridine synthase C OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=truC PE=3 SV=1 610 810 3.0E-09
sp|P33643|RLUD_ECOLI Ribosomal large subunit pseudouridine synthase D OS=Escherichia coli (strain K12) GN=rluD PE=1 SV=4 610 783 3.0E-09
sp|P59831|RLUA_HAEDU Ribosomal large subunit pseudouridine synthase A OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rluA PE=3 SV=1 611 786 4.0E-09
sp|Q82WZ5|RLUD_NITEU Ribosomal large subunit pseudouridine synthase D OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rluD PE=3 SV=1 610 783 4.0E-09
sp|P41345|FENR2_ORYSJ Ferredoxin--NADP reductase, root isozyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0784700 PE=1 SV=1 368 557 5.0E-09
sp|P41346|FENR_VICFA Ferredoxin--NADP reductase, chloroplastic OS=Vicia faba GN=PETH PE=2 SV=1 368 557 5.0E-09
sp|Q8Z439|TRUC_SALTI tRNA pseudouridine synthase C OS=Salmonella typhi GN=truC PE=3 SV=1 610 780 6.0E-09
sp|P0A5T3|Y1567_MYCBO Uncharacterized RNA pseudouridine synthase Mb1567 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1567 PE=3 SV=1 610 783 6.0E-09
sp|P9WHQ3|Y1540_MYCTU Uncharacterized RNA pseudouridine synthase Rv1540 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1540 PE=1 SV=1 610 783 6.0E-09
sp|P9WHQ2|Y1540_MYCTO Uncharacterized RNA pseudouridine synthase MT1592 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1592 PE=3 SV=1 610 783 6.0E-09
sp|P10933|FENR1_PEA Ferredoxin--NADP reductase, leaf isozyme, chloroplastic OS=Pisum sativum GN=PETH PE=1 SV=1 368 557 6.0E-09
sp|Q9K0B0|RLUD_NEIMB Ribosomal large subunit pseudouridine synthase D OS=Neisseria meningitidis serogroup B (strain MC58) GN=rluD PE=3 SV=1 610 812 6.0E-09
sp|Q8FEF9|TRUC_ECOL6 tRNA pseudouridine synthase C OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=truC PE=3 SV=1 610 812 7.0E-09
sp|Q9M0V6|FNRR1_ARATH Ferredoxin--NADP reductase, root isozyme 1, chloroplastic OS=Arabidopsis thaliana GN=RFNR1 PE=2 SV=2 368 557 7.0E-09
sp|P44445|RLUD_HAEIN Ribosomal large subunit pseudouridine synthase D OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rluD PE=3 SV=1 610 783 7.0E-09
sp|P00454|FENR_SPISP Ferredoxin--NADP reductase OS=Spirulina sp. GN=petH PE=1 SV=1 368 567 9.0E-09
sp|Q87S65|RLUD_VIBPA Ribosomal large subunit pseudouridine synthase D OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rluD PE=3 SV=1 610 783 1.0E-08
sp|Q8X6T6|TRUC_ECO57 tRNA pseudouridine synthase C OS=Escherichia coli O157:H7 GN=truC PE=3 SV=1 610 812 1.0E-08
sp|Q12069|PUS9_YEAST tRNA pseudouridine(32) synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUS9 PE=1 SV=1 610 783 1.0E-08
sp|P44433|RLUC_HAEIN Ribosomal large subunit pseudouridine synthase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rluC PE=3 SV=1 606 823 1.0E-08
sp|Q3ECD0|PUS2_ARATH RNA pseudouridine synthase 2, chloroplastic OS=Arabidopsis thaliana GN=At1g76050 PE=2 SV=1 610 783 2.0E-08
sp|P65836|RLUD_SALTY Ribosomal large subunit pseudouridine synthase D OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rluD PE=1 SV=2 610 783 2.0E-08
sp|P65837|RLUD_SALTI Ribosomal large subunit pseudouridine synthase D OS=Salmonella typhi GN=rluD PE=3 SV=2 610 783 2.0E-08
sp|P0AA42|TRUC_SHIFL tRNA pseudouridine synthase C OS=Shigella flexneri GN=truC PE=3 SV=1 610 812 2.0E-08
sp|P0AA41|TRUC_ECOLI tRNA pseudouridine synthase C OS=Escherichia coli (strain K12) GN=truC PE=1 SV=1 610 812 2.0E-08
sp|Q41014|FENR2_PEA Ferredoxin--NADP reductase, root isozyme, chloroplastic OS=Pisum sativum PE=2 SV=2 400 562 2.0E-08
sp|Q9ZL98|Y745_HELPJ Uncharacterized RNA pseudouridine synthase jhp_0682 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0682 PE=3 SV=1 606 783 2.0E-08
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 8 145 2.0E-08
sp|Q8P682|RLUD_XANCP Ribosomal large subunit pseudouridine synthase D OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rluD PE=3 SV=1 610 783 2.0E-08
sp|Q5XET6|PUS3_ARATH RNA pseudouridine synthase 3, mitochondrial OS=Arabidopsis thaliana GN=At1g78910 PE=2 SV=1 605 783 2.0E-08
sp|P41344|FENR1_ORYSJ Ferredoxin--NADP reductase, leaf isozyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0107700 PE=2 SV=1 368 557 3.0E-08
sp|Q9FKW6|FNRL1_ARATH Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic OS=Arabidopsis thaliana GN=LFNR1 PE=1 SV=1 368 557 3.0E-08
sp|O50310|Y723_CHLP8 Uncharacterized RNA pseudouridine synthase Cpar_0723 OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_0723 PE=3 SV=1 592 783 4.0E-08
sp|P44813|MIOC_HAEIN Protein MioC homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mioC PE=3 SV=1 5 126 5.0E-08
sp|Q87LD3|RLUA_VIBPA Ribosomal large subunit pseudouridine synthase A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rluA PE=3 SV=1 610 783 5.0E-08
sp|O25441|Y745_HELPY Uncharacterized RNA pseudouridine synthase HP_0745 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0745 PE=3 SV=1 606 783 5.0E-08
sp|Q96CM3|RUSD4_HUMAN RNA pseudouridylate synthase domain-containing protein 4 OS=Homo sapiens GN=RPUSD4 PE=1 SV=1 594 798 6.0E-08
sp|O23877|FENR3_ORYSJ Ferredoxin--NADP reductase, embryo isozyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0147900 PE=1 SV=1 368 557 7.0E-08
sp|Q8FIP7|RLUC_ECOL6 Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rluC PE=3 SV=1 610 820 7.0E-08
sp|Q87AR7|RLUD_XYLFT Ribosomal large subunit pseudouridine synthase D OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rluD PE=3 SV=1 610 783 8.0E-08
sp|Q7VQH2|CYSJ_BLOFL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Blochmannia floridanus GN=cysJ PE=3 SV=1 1 232 9.0E-08
sp|Q8Z7J7|RLUC_SALTI Ribosomal large subunit pseudouridine synthase C OS=Salmonella typhi GN=rluC PE=3 SV=1 610 820 9.0E-08
sp|Q8DEV0|RLUD_VIBVU Ribosomal large subunit pseudouridine synthase D OS=Vibrio vulnificus (strain CMCP6) GN=rluD PE=3 SV=1 610 783 1.0E-07
sp|Q8ZQ16|RLUC_SALTY Ribosomal large subunit pseudouridine synthase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rluC PE=3 SV=1 610 820 1.0E-07
sp|Q9PET9|RLUD_XYLFA Ribosomal large subunit pseudouridine synthase D OS=Xylella fastidiosa (strain 9a5c) GN=rluD PE=3 SV=1 610 783 1.0E-07
sp|O04977|FENR1_TOBAC Ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic OS=Nicotiana tabacum GN=PETH PE=2 SV=1 368 557 1.0E-07
sp|Q9HZM9|RLUC_PSEAE Ribosomal large subunit pseudouridine synthase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rluC PE=3 SV=1 606 812 2.0E-07
sp|Q8DCG0|RLUA_VIBVU Ribosomal large subunit pseudouridine synthase A OS=Vibrio vulnificus (strain CMCP6) GN=rluA PE=3 SV=1 610 783 2.0E-07
sp|Q92037|NOS2_CARAU Nitric oxide synthase, inducible (Fragment) OS=Carassius auratus GN=nos2 PE=2 SV=1 5 106 2.0E-07
sp|Q8X8J3|RLUC_ECO57 Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli O157:H7 GN=rluC PE=3 SV=1 610 820 3.0E-07
sp|P0AA40|RLUC_SHIFL Ribosomal large subunit pseudouridine synthase C OS=Shigella flexneri GN=rluC PE=3 SV=1 610 820 3.0E-07
sp|P0AA39|RLUC_ECOLI Ribosomal large subunit pseudouridine synthase C OS=Escherichia coli (strain K12) GN=rluC PE=1 SV=1 610 820 3.0E-07
sp|P43930|Y042_HAEIN Uncharacterized RNA pseudouridine synthase HI_0042 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0042 PE=3 SV=1 606 783 7.0E-07
sp|Q9L6A2|MIOC_PASMU Protein MioC homolog OS=Pasteurella multocida (strain Pm70) GN=mioC PE=3 SV=1 5 126 2.0E-06
sp|Q12362|RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB2 PE=1 SV=1 610 788 2.0E-06
sp|P72970|Y1592_SYNY3 Uncharacterized RNA pseudouridine synthase slr1592 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1592 PE=3 SV=1 659 783 4.0E-06
sp|Q9AIX6|BOXA_AZOEV Benzoyl-CoA oxygenase component A OS=Azoarcus evansii GN=boxA PE=1 SV=1 368 558 7.0E-06
sp|Q9NV66|TYW1_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1 PE=2 SV=2 8 159 7.0E-06
sp|Q9CWX4|RUSD4_MOUSE RNA pseudouridylate synthase domain-containing protein 4 OS=Mus musculus GN=Rpusd4 PE=2 SV=1 594 783 8.0E-06
sp|Q6DBR0|RUSD4_DANRE RNA pseudouridylate synthase domain-containing protein 4 OS=Danio rerio GN=rpusd4 PE=2 SV=1 611 796 8.0E-06
sp|Q8ZFU1|RLUC_YERPE Ribosomal large subunit pseudouridine synthase C OS=Yersinia pestis GN=rluC PE=3 SV=1 610 813 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0009451 RNA modification Yes
GO:0009982 pseudouridine synthase activity Yes
GO:0003723 RNA binding Yes
GO:0001522 pseudouridine synthesis Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0016853 isomerase activity No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0044237 cellular metabolic process No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|782100
MPERRLLILFATETGTAQDIADRIARESRNLLFKSQVVSVDCYTLENLVEEDFVIFVVSTTGSGVEPRAMTPMWN
MLLSANLPPDLFEDLSFAIFGLGDTSYDKFCWPAKMLSKRLRSLGATEVCERGEGDEQHPFGIDGAFEPWLTKLS
DTISDLYPLPNDIAVIPTPQIPESRVILKSSDSTGESKLPSSPGSLSATIISNRRMTAKGWNQDVRHIQIQLEKD
VDYLPGDLAIIHPIASSQEVEDVLDSLGWTRIADEPLSIQRRLEDQSLPASLPETFTMRTLFSHHLDFNAIPRRT
FFQYLRNFNSDETEREKLDEFLSKEGADELYEYCYKVKRTIREILSEFRKSSIPQNYVFDVFPFLRPRQFSIASS
AKAHKRQVHLCAAIVKYKTQLKVPRKGVCTTYLSNLGPGSKLQVEIQRGLLKLPPSINTPVICVGPGTGVAPMRA
IIEERLNLGSQSNTLYFGCRSATKDEHYADEWRRYSETCGLTYRVAHSRDGPEGVKRTYVQDLIEQDSYRIWKLL
EDEKAWVYISGSSNKMPAGVRAALAKILEKEGGYSEEDSKKYVEGMTIKVFLHFFRTHLNSRSTMGTGVKPNSIV
QAKKYVEKYVVYHDRGIIVSNKPKNMICQLSSSQSVKSLKFNILCKGIQQHLDLPGLPYPVHRLDQNTTGALVLG
RTQDWARNLSHQFLHRTIGKTYLALVYGRKNQFSGSFGVIENRLGKVEGRVRFDPHGTQTKTEWELLGSSPKVPL
SLMRLKLYTGHKHQLRFHLANCLEAPVVGDDLYKIPHLNELVQQTITVPKKVMFLHSHELSLERWTKFGHTPRSK
NHLTKVKTKTKLISSYSQGTWLMTKSRRIGKSMADSTRNDACLRLVT*
Coding >Agabi119p4|782100
ATGCCCGAACGTCGACTTCTGATTCTCTTCGCCACTGAAACAGGAACTGCACAAGACATTGCTGATAGAATTGCT
CGCGAGTCAAGAAACCTACTTTTCAAAAGTCAGGTCGTGAGTGTTGACTGCTATACATTGGAAAATCTTGTCGAG
GAAGACTTTGTGATTTTCGTCGTGTCGACGACCGGCTCCGGTGTTGAGCCACGCGCTATGACTCCCATGTGGAAT
ATGTTACTCTCGGCGAATCTTCCTCCAGACCTGTTCGAGGATTTGTCATTCGCAATTTTTGGTCTTGGAGACACG
TCATACGATAAATTTTGTTGGCCAGCAAAGATGCTGTCAAAAAGGCTGAGGAGTCTAGGCGCCACGGAGGTGTGT
GAACGTGGCGAAGGTGACGAACAGCATCCTTTCGGAATAGACGGTGCCTTCGAACCTTGGTTGACTAAGCTCTCC
GATACGATATCAGATTTATACCCCCTGCCAAACGATATAGCGGTTATACCAACCCCACAGATCCCCGAGTCTCGG
GTGATTTTGAAGTCTAGTGATTCTACCGGAGAGTCGAAGCTGCCTTCTTCCCCTGGATCTTTATCTGCGACCATT
ATAAGCAACAGGAGGATGACAGCGAAAGGTTGGAACCAAGATGTTCGACATATTCAAATCCAGCTAGAGAAGGAT
GTTGACTACTTACCTGGAGACCTGGCTATAATCCACCCAATAGCCAGCTCCCAGGAGGTTGAAGATGTTCTTGAT
TCCTTAGGGTGGACAAGAATCGCTGATGAACCGCTATCAATCCAAAGAAGACTTGAGGACCAGAGCCTTCCAGCT
TCATTGCCCGAGACCTTTACCATGAGAACCCTCTTTTCTCACCATCTTGATTTTAATGCCATCCCGAGACGGACG
TTTTTCCAATATCTTAGAAACTTTAATTCTGATGAGACGGAACGCGAAAAATTAGACGAGTTTTTGTCCAAGGAA
GGAGCTGATGAGTTATATGAATATTGCTATAAAGTTAAACGGACGATTAGAGAGATCCTATCTGAATTTAGGAAG
TCGTCTATACCTCAAAATTACGTGTTCGATGTGTTTCCATTCCTGCGGCCTCGACAGTTTTCTATAGCCAGCTCC
GCCAAGGCACATAAACGTCAAGTGCACCTTTGTGCGGCAATAGTGAAATATAAAACACAACTCAAGGTTCCGCGC
AAAGGTGTCTGTACAACTTATCTCTCCAACTTAGGGCCAGGAAGTAAACTGCAAGTCGAAATTCAGAGAGGCCTG
TTGAAGCTTCCACCTTCAATCAATACCCCAGTAATTTGCGTTGGTCCTGGCACTGGTGTTGCACCCATGCGAGCG
ATCATTGAGGAGCGGTTGAACCTCGGTTCACAGTCGAATACTCTGTATTTCGGGTGCCGCTCCGCGACCAAGGAC
GAACATTACGCTGATGAATGGAGACGATATTCTGAAACTTGTGGTTTGACCTACCGCGTCGCTCATTCTCGAGAT
GGACCCGAAGGCGTTAAGCGGACGTACGTTCAAGACCTCATTGAGCAAGATTCATATCGAATATGGAAGCTCTTG
GAAGATGAGAAGGCCTGGGTCTATATTTCTGGATCGTCGAATAAAATGCCTGCTGGTGTTAGAGCTGCGCTGGCG
AAAATTTTGGAGAAGGAAGGTGGCTATTCAGAGGAGGACTCCAAGAAATATGTTGAAGGCATGACGATCAAAGTT
TTCCTGCACTTTTTTCGCACACACTTGAATTCGCGCTCGACAATGGGGACTGGAGTCAAGCCAAACAGCATCGTG
CAGGCCAAGAAATACGTGGAAAAATACGTGGTTTATCATGACAGAGGTATAATTGTCTCCAACAAGCCAAAGAAC
ATGATTTGTCAACTGTCTTCTAGTCAATCAGTCAAGTCTTTGAAATTTAACATTCTTTGTAAAGGTATCCAGCAG
CACCTTGACCTACCAGGGCTACCCTATCCTGTACATCGCTTGGATCAGAATACGACTGGAGCACTCGTACTCGGT
AGGACCCAAGACTGGGCTAGAAATCTCTCGCATCAATTCCTCCACCGTACAATTGGAAAGACGTATTTGGCTCTC
GTGTACGGAAGAAAAAATCAATTTTCCGGATCTTTTGGCGTTATTGAAAATCGGCTTGGTAAAGTAGAGGGCCGT
GTTCGATTCGATCCCCATGGGACCCAGACGAAAACTGAATGGGAGCTGCTTGGGTCATCACCAAAAGTGCCGCTG
TCGCTTATGCGCTTAAAGTTGTACACTGGGCACAAGCACCAGTTGCGGTTTCATCTGGCGAATTGCCTCGAAGCA
CCTGTCGTTGGAGACGATCTTTACAAGATACCACATCTGAATGAATTAGTCCAGCAGACCATCACCGTACCAAAA
AAAGTAATGTTTTTGCATTCCCATGAGCTTTCCTTGGAGCGATGGACCAAGTTCGGTCATACTCCGCGCTCGAAG
AATCACCTGACGAAGGTGAAGACGAAGACTAAATTGATCTCCTCTTACTCGCAGGGAACATGGCTAATGACAAAG
AGCAGAAGGATAGGAAAGAGTATGGCAGATTCAACTAGAAATGATGCGTGCCTCAGGCTGGTTACTTGA
Transcript >Agabi119p4|782100
ATGCCCGAACGTCGACTTCTGATTCTCTTCGCCACTGAAACAGGAACTGCACAAGACATTGCTGATAGAATTGCT
CGCGAGTCAAGAAACCTACTTTTCAAAAGTCAGGTCGTGAGTGTTGACTGCTATACATTGGAAAATCTTGTCGAG
GAAGACTTTGTGATTTTCGTCGTGTCGACGACCGGCTCCGGTGTTGAGCCACGCGCTATGACTCCCATGTGGAAT
ATGTTACTCTCGGCGAATCTTCCTCCAGACCTGTTCGAGGATTTGTCATTCGCAATTTTTGGTCTTGGAGACACG
TCATACGATAAATTTTGTTGGCCAGCAAAGATGCTGTCAAAAAGGCTGAGGAGTCTAGGCGCCACGGAGGTGTGT
GAACGTGGCGAAGGTGACGAACAGCATCCTTTCGGAATAGACGGTGCCTTCGAACCTTGGTTGACTAAGCTCTCC
GATACGATATCAGATTTATACCCCCTGCCAAACGATATAGCGGTTATACCAACCCCACAGATCCCCGAGTCTCGG
GTGATTTTGAAGTCTAGTGATTCTACCGGAGAGTCGAAGCTGCCTTCTTCCCCTGGATCTTTATCTGCGACCATT
ATAAGCAACAGGAGGATGACAGCGAAAGGTTGGAACCAAGATGTTCGACATATTCAAATCCAGCTAGAGAAGGAT
GTTGACTACTTACCTGGAGACCTGGCTATAATCCACCCAATAGCCAGCTCCCAGGAGGTTGAAGATGTTCTTGAT
TCCTTAGGGTGGACAAGAATCGCTGATGAACCGCTATCAATCCAAAGAAGACTTGAGGACCAGAGCCTTCCAGCT
TCATTGCCCGAGACCTTTACCATGAGAACCCTCTTTTCTCACCATCTTGATTTTAATGCCATCCCGAGACGGACG
TTTTTCCAATATCTTAGAAACTTTAATTCTGATGAGACGGAACGCGAAAAATTAGACGAGTTTTTGTCCAAGGAA
GGAGCTGATGAGTTATATGAATATTGCTATAAAGTTAAACGGACGATTAGAGAGATCCTATCTGAATTTAGGAAG
TCGTCTATACCTCAAAATTACGTGTTCGATGTGTTTCCATTCCTGCGGCCTCGACAGTTTTCTATAGCCAGCTCC
GCCAAGGCACATAAACGTCAAGTGCACCTTTGTGCGGCAATAGTGAAATATAAAACACAACTCAAGGTTCCGCGC
AAAGGTGTCTGTACAACTTATCTCTCCAACTTAGGGCCAGGAAGTAAACTGCAAGTCGAAATTCAGAGAGGCCTG
TTGAAGCTTCCACCTTCAATCAATACCCCAGTAATTTGCGTTGGTCCTGGCACTGGTGTTGCACCCATGCGAGCG
ATCATTGAGGAGCGGTTGAACCTCGGTTCACAGTCGAATACTCTGTATTTCGGGTGCCGCTCCGCGACCAAGGAC
GAACATTACGCTGATGAATGGAGACGATATTCTGAAACTTGTGGTTTGACCTACCGCGTCGCTCATTCTCGAGAT
GGACCCGAAGGCGTTAAGCGGACGTACGTTCAAGACCTCATTGAGCAAGATTCATATCGAATATGGAAGCTCTTG
GAAGATGAGAAGGCCTGGGTCTATATTTCTGGATCGTCGAATAAAATGCCTGCTGGTGTTAGAGCTGCGCTGGCG
AAAATTTTGGAGAAGGAAGGTGGCTATTCAGAGGAGGACTCCAAGAAATATGTTGAAGGCATGACGATCAAAGTT
TTCCTGCACTTTTTTCGCACACACTTGAATTCGCGCTCGACAATGGGGACTGGAGTCAAGCCAAACAGCATCGTG
CAGGCCAAGAAATACGTGGAAAAATACGTGGTTTATCATGACAGAGGTATAATTGTCTCCAACAAGCCAAAGAAC
ATGATTTGTCAACTGTCTTCTAGTCAATCAGTCAAGTCTTTGAAATTTAACATTCTTTGTAAAGGTATCCAGCAG
CACCTTGACCTACCAGGGCTACCCTATCCTGTACATCGCTTGGATCAGAATACGACTGGAGCACTCGTACTCGGT
AGGACCCAAGACTGGGCTAGAAATCTCTCGCATCAATTCCTCCACCGTACAATTGGAAAGACGTATTTGGCTCTC
GTGTACGGAAGAAAAAATCAATTTTCCGGATCTTTTGGCGTTATTGAAAATCGGCTTGGTAAAGTAGAGGGCCGT
GTTCGATTCGATCCCCATGGGACCCAGACGAAAACTGAATGGGAGCTGCTTGGGTCATCACCAAAAGTGCCGCTG
TCGCTTATGCGCTTAAAGTTGTACACTGGGCACAAGCACCAGTTGCGGTTTCATCTGGCGAATTGCCTCGAAGCA
CCTGTCGTTGGAGACGATCTTTACAAGATACCACATCTGAATGAATTAGTCCAGCAGACCATCACCGTACCAAAA
AAAGTAATGTTTTTGCATTCCCATGAGCTTTCCTTGGAGCGATGGACCAAGTTCGGTCATACTCCGCGCTCGAAG
AATCACCTGACGAAGGTGAAGACGAAGACTAAATTGATCTCCTCTTACTCGCAGGGAACATGGCTAATGACAAAG
AGCAGAAGGATAGGAAAGAGTATGGCAGATTCAACTAGAAATGATGCGTGCCTCAGGCTGGTTACTTGA
Gene >Agabi119p4|782100
ATGCCCGAACGTCGACTTCTGATTCTCTTCGCCACTGAAACAGGAACTGCACAAGACATTGCTGATAGAATTGCT
CGCGAGTCAAGAAACCTACTTTTCAAAAGTCAGGTCGTGAGTGTTGACTGCTATACATTGGTGTGTCTTTTTCGT
GACGCATGATTTGTACTCGTTGGGTTTAGAAAACACAAACAGGAAAATCTTGTCGAGGAAGACTTTGTGATTTTC
GTCGTGTCGACGACCGGCTCCGGTGTTGAGCCACGCGCTATGACTCCCATGTGGAATATGTTACTCTCGGCGAAT
CTTCCTCCAGACCTGTTCGAGGATTTGTCATTCGCAATTTTTGGTCTTGGAGACACGTCATACGATAAATTTTGT
TGGCCAGCAAAGATGCTGTCAAAAAGGCTGAGGAGTCTAGGCGCCACGGAGGTGTGTGAACGTGGCGAAGGTGAC
GAACAGCATCCTTTCGGGTAGGTTCTTTGTTTGTGACTCGAACAAACATGAATAACATATGCCCTGCAGAATAGA
CGGTGCCTTCGAACCTTGGTTGACTAAGCTCTCCGATACGATATCAGATTTATACCCCCTGCCAAACGATATAGC
GGTTATACCAACCCCACAGATCCCCGAGTCTCGGGTGATTTTGAAGTCTAGTGATTCTACCGGAGAGTCGAAGCT
GCCTTCTTCCCCTGGATCTTTATCTGCGACCATTATAAGCAACAGGAGGATGACAGCGAAAGGTTGGAACCAAGA
TGTTCGACATATTCAAATCCAGCTAGAGAAGGATGTTGAGTAGGTCGATGACTCAATTGATTTCGGTCCAGCTCA
TAAAAATCCAGCTACTTACCTGGAGACCTGGCTATAATCCACCCAATAGCCAGCTCCCAGGAGGTTGAAGATGTT
CTTGATTCCTTAGGGTGGACAAGAATCGCTGATGAACCGCTATCAATCCAAAGAAGACTTGAGGGTATGTAACCA
TTGCTGTCGTAAATATTAACAACTATTCAGCTATTGTAGACCAGAGCCTTCCAGCTTCATTGCCCGAGACCTTTA
CCATGAGAACCCTCTTTTCTCACCATCTTGATTTTAATGCCATCCCGAGACGGACGTTTTTCCAATATCTTAGAA
ACTTTAATTCTGATGAGACGGAACGCGAAAAATTAGACGAGTTTTTGTCCAAGGAAGGAGCTGTAAGTATTCTGT
TTCGCTATAGTAAAAGTTGTGCTGATGTGTCTAGGATGAGTTATATGAATATTGCTATAAAGTTAAACGGACGAT
TAGAGAGATCCTATCTGAATTTAGGAAGTCGTCTATACCTCAAAATTACGTGTTCGATGTGTTTCCATTCCTGCG
GCCTCGACAGTTTTCTATAGCCAGCTCCGCCAAGGTGAGAGTCAATGGTGAATATAATCCGGGATTCGCTTTCCT
GACGTCGTTACAGGCACATAAACGTCAAGTGCACCTTTGTGCGGCAATAGTGAAATATAAAACACAACTCAAGGT
TCCGCGCAAAGGTGTCTGTACAACTTATCTCTCCAACTTAGGGCCAGGTGAGCTCATTTTTTATATACATGTGGT
ACATCTCAAACAAACTACGATAGGAAGTAAACTGCAAGTCGAAATTCAGAGAGGCCTGTTGAAGCTTCCACCTTC
AATCAATACCCCAGTAATTTGCGTTGGTCCTGGCACTGGTGTTGCACCCATGCGAGCGATCATTGAGGAGCGGTT
GAACCTCGGTTCACAGTGTACGTTTTTCTGATAGCAGTCTAGCACACGAATTGATTGCTGTTGCAGCGAATACTC
TGTATTTCGGGTGCCGCTCCGCGACCAAGGACGAACATTACGCTGATGAATGGAGACGATATTCTGAAACTTGTG
GTTTGACCTACCGCGTCGCTCATTCTCGAGATGGACCCGAAGGCGTTAAGCGGACGTACGTTCAAGACCTCATTG
AGCAAGATTCATATCGAATATGGAAGCTCTTGGAAGATGAGAAGGCCTGGGTCTATATTTCTGGGTACGACCTTC
TAGTTATCCTTGTTTTTGAGATGATTTTGATGCAAATTTATGTGTTAGATCGTCGAATAAAATGCCTGCTGGTGT
TAGAGCTGCGCTGGCGAAAATTTTGGAGAAGGAAGGTGGCTATTCAGAGGAGGACTCCAAGAAATATGTTGAAGG
CATGGTGCGCGAGGGGAGATTGATCGAGGAATGCTGGAGTTGATAACCTTCGAAGAGCTGTTCAGCATATCTAGA
GCAAGAGATGTATTCCGACCAATTTCTCGGTCATTATAAGTTATCATAACGTCATTGTCAGTGTTGGTTGTTGGT
TCGTGACGTCACGCGACTAGACGATCAAAGTTTTCCTGCACTTTTTTCGCACACACTTGAATTCGCGCTCGACAA
TGGGGACTGGAGTCAAGCCAAACAGCATCGTGCAGGCCAAGAAATACGTGGAAAAATACGTGGTTTATCATGACA
GAGGTATAATTGTCTCCAACAAGCCAAAGAACATGATTTGTCAACTGTCTTCTAGTCAATCAGTCAAGGCGAGTC
GTCTTCCTCCGAAACGTGCAGATTGAAGCCAACTCGAAGAATAGTCTTTGAAATTTAACATTCTTTGTAAAGGTT
GACGAATTTTTTCTATGCGCACGCCTATTCTAATTTCGCACCAGGTATCCAGCAGCACCTTGACCTACCAGGGCT
ACCCTATCCTGTACATCGCTTGGATCAGGTCAGTGACTCATATAGAAGAAGCACTCTACATTCGCTGACGGTGAC
CTAGAATACGACTGGAGCACTCGTACTCGGTAGGACCCAAGACTGGGCTAGAAATCTCTCGCATCAATTCCTCCA
CCGTACAATTGGAAAGACGTATTTGGCTCTCGTGTACGGAAGAAAAAATCAATTTTCCGGATCTTTTGGCGTTAT
TGAAAATCGGCTTGGTAAAGTAGAGGGCCGTGTTCGATTCGATCCCCATGGGACCCAGACGAAAACTGAATGGGA
GCTGCTTGGGTCATCAGTATGTTCAGGCAAATTTTACTCCTGCCATTGTTCTGGTTGAATATGTTTTCTTCCAGC
CAAAAGTGCCGCTGTCGCTTATGCGCTTAAAGTTGTACACTGGGCACAAGCACCAGTTGCGGTTTCATCTGGCGA
ATTGCCTCGAAGGTCTGGGCATGTTTCTCTGTTAAACATCGCATCACTCAACGCTCAGATTAGCACCTGTCGTTG
GAGACGATCTTTACAAGATACCACATCTGAATGAATTAGTCCAGCAGACCATCACCGTACCAAAAAAAGTAATGT
TTTTGCATTCCCATGAGCTTTCCTTGGAGGTATGAAAGTTCTAATGAATCTTTCGTGGCAGCGTTAGCTTACCCA
CCACATAGCGATGGACCAAGTTCGGTCATACTCCGCGCTCGAAGTATACACAAACTTTTCGTGTACCTGTGCCGA
CGAAATTTAGAGTTTTATGTCGTGATGCGCAGATACCAGTTGACGAAACGTTTCTCAAAGAAGGAGCAATGCTTA
TAAATGGTGCACCATGGACGACACCAGACCAATTACATCACGAGGAAGAAAAGTGCTGGATTTCGCCTAAACTAC
TACCGAATTCAAAGGAATCACCTGACGAAGGTGAAGACGAAGACTAAATTGGTACTGTACATGATTTGTTTTAAT
AATTTAGTGGTTCTTAATCTATAAACGTCGTTTCGGTACAATATAGATCTCCTCTTACTCGCAGGGAACATGGCT
AATGACAAAGAGCAGAAGGATAGGAAAGAGTATGGCAGATTCAACTAGAAATGATGCGTGCCGTTCGTGATTTGG
CTTGCCCCTATGGGTTGTTCCGATTCGCCTGCTGATTGTTCTTCTCAGTCAGGCTGGTTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail