Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|781450
Gene name
Locationscaffold_13:139240..142174
Strand+
Gene length (bp)2934
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.5E-75 22 728

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 6 828 3.0E-111
sp|F4JMJ1|HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana GN=HSP70-17 PE=2 SV=1 15 841 7.0E-107
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 21 842 7.0E-106
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 21 842 2.0E-105
sp|Q60432|HYOU1_CRIGR Hypoxia up-regulated protein 1 OS=Cricetulus griseus GN=HYOU1 PE=2 SV=1 21 876 7.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZUW2|HYOU1_DANRE Hypoxia up-regulated protein 1 OS=Danio rerio GN=hyou1 PE=2 SV=1 6 828 3.0E-111
sp|F4JMJ1|HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana GN=HSP70-17 PE=2 SV=1 15 841 7.0E-107
sp|Q9JKR6|HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus GN=Hyou1 PE=1 SV=1 21 842 7.0E-106
sp|Q63617|HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus GN=Hyou1 PE=1 SV=1 21 842 2.0E-105
sp|Q60432|HYOU1_CRIGR Hypoxia up-regulated protein 1 OS=Cricetulus griseus GN=HYOU1 PE=2 SV=1 21 876 7.0E-105
sp|Q9Y4L1|HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens GN=HYOU1 PE=1 SV=1 21 842 2.0E-103
sp|Q566I3|HYOU1_XENLA Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus laevis GN=hyou1 PE=1 SV=2 6 555 5.0E-99
sp|Q0VA61|HYOU1_XENTR Hypoxia up-regulated protein 1 (Fragment) OS=Xenopus tropicalis GN=hyou1 PE=2 SV=2 10 594 2.0E-98
sp|Q10061|LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.06 PE=3 SV=1 4 439 8.0E-96
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 7 476 7.0E-93
sp|Q556U6|BIP1_DICDI Luminal-binding protein 1 OS=Dictyostelium discoideum GN=bip1-1 PE=3 SV=1 9 421 2.0E-66
sp|Q0IIM3|HS105_BOVIN Heat shock protein 105 kDa OS=Bos taurus GN=HSPH1 PE=2 SV=1 21 855 1.0E-61
sp|Q92598|HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens GN=HSPH1 PE=1 SV=1 21 855 1.0E-61
sp|Q5R606|HS105_PONAB Heat shock protein 105 kDa OS=Pongo abelii GN=HSPH1 PE=2 SV=1 21 855 1.0E-61
sp|Q61699|HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus GN=Hsph1 PE=1 SV=2 21 838 6.0E-60
sp|O88600|HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus GN=Hspa4 PE=1 SV=1 21 820 7.0E-60
sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens GN=HSPA4L PE=1 SV=3 125 867 3.0E-59
sp|Q2TFN9|HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris GN=HSPA4 PE=1 SV=1 21 820 1.0E-58
sp|P48722|HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus GN=Hspa4l PE=1 SV=2 125 864 2.0E-58
sp|Q61316|HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus GN=Hspa4 PE=1 SV=1 21 820 7.0E-58
sp|P36016|LHS1_YEAST Heat shock protein 70 homolog LHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHS1 PE=1 SV=1 3 450 4.0E-57
sp|Q5RDM4|HSP74_PONAB Heat shock 70 kDa protein 4 OS=Pongo abelii GN=HSPA4 PE=2 SV=1 21 820 5.0E-57
sp|Q60446|HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus GN=HSPH1 PE=2 SV=1 21 838 6.0E-57
sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens GN=HSPA4 PE=1 SV=4 21 820 8.0E-57
sp|Q66HA8|HS105_RAT Heat shock protein 105 kDa OS=Rattus norvegicus GN=Hsph1 PE=1 SV=1 21 838 1.0E-56
sp|Q6FU50|LHS1_CANGA Heat shock protein 70 homolog LHS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LHS1 PE=3 SV=1 9 479 3.0E-56
sp|Q9SAB1|HSP7Q_ARATH Heat shock 70 kDa protein 16 OS=Arabidopsis thaliana GN=HSP70-16 PE=2 SV=1 21 849 3.0E-55
sp|Q875P5|HSP7F_LACK1 Heat shock protein homolog SSE1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SSE1 PE=3 SV=1 43 728 4.0E-50
sp|Q94738|HSP97_STRFN 97 kDa heat shock protein OS=Strongylocentrotus franciscanus GN=HSP110 PE=2 SV=1 21 820 3.0E-49
sp|Q875V0|HSP7F_NAUCC Heat shock protein homolog SSE1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=SSE1 PE=3 SV=1 43 728 1.0E-48
sp|F4HQD4|HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana GN=HSP70-15 PE=1 SV=1 21 854 2.0E-48
sp|P32589|HSP7F_YEAST Heat shock protein homolog SSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE1 PE=1 SV=4 43 728 4.0E-48
sp|Q9S7C0|HSP7O_ARATH Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana GN=HSP70-14 PE=2 SV=1 21 870 3.0E-47
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 21 473 3.0E-46
sp|Q06068|HSP97_STRPU 97 kDa heat shock protein OS=Strongylocentrotus purpuratus PE=1 SV=2 21 820 3.0E-46
sp|O59838|HSP7F_SCHPO Heat shock protein homolog pss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pss1 PE=1 SV=2 21 473 3.0E-45
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 19 424 3.0E-45
sp|Q74ZJ0|HSP7F_ASHGO Heat shock protein homolog SSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSE1 PE=3 SV=1 23 728 4.0E-45
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 20 466 6.0E-45
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 23 424 7.0E-45
sp|Q6FJI3|HSP7F_CANGA Heat shock protein homolog SSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSE1 PE=3 SV=1 23 734 7.0E-45
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 23 424 2.0E-44
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 20 441 2.0E-44
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 20 466 3.0E-44
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 3 441 3.0E-44
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 20 466 4.0E-44
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 23 424 5.0E-44
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 23 424 5.0E-44
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 23 424 5.0E-44
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 20 421 6.0E-44
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 20 466 8.0E-44
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 20 421 8.0E-44
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 21 424 9.0E-44
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 23 424 1.0E-43
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 23 424 1.0E-43
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 23 424 1.0E-43
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 11 524 2.0E-43
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 20 466 2.0E-43
sp|Q6TMK3|HSP88_DICDI Heat shock protein 88 OS=Dictyostelium discoideum GN=hspH PE=1 SV=1 22 428 3.0E-43
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 20 419 3.0E-43
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 23 424 4.0E-43
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 20 421 5.0E-43
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 20 421 8.0E-43
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 23 466 1.0E-42
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 21 424 2.0E-42
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 21 424 2.0E-42
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 20 421 3.0E-42
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 23 424 4.0E-42
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 23 466 4.0E-42
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 20 466 6.0E-42
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 17 424 7.0E-42
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 17 424 9.0E-42
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 4 421 1.0E-41
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 4 421 1.0E-41
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 4 421 1.0E-41
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 23 461 1.0E-41
sp|P32590|HSP79_YEAST Heat shock protein homolog SSE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSE2 PE=1 SV=3 43 728 1.0E-41
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 23 424 2.0E-41
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 17 424 3.0E-41
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 23 424 3.0E-41
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 23 461 3.0E-41
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 17 424 4.0E-41
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 20 466 4.0E-41
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 23 461 4.0E-41
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 17 424 4.0E-41
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 20 441 4.0E-41
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 23 424 6.0E-41
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 16 424 8.0E-41
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 19 466 9.0E-41
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 6 441 9.0E-41
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 19 461 1.0E-40
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 19 424 1.0E-40
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 19 424 1.0E-40
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 19 424 1.0E-40
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 17 406 1.0E-40
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 21 424 1.0E-40
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 21 424 1.0E-40
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 23 461 2.0E-40
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 23 424 2.0E-40
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 21 424 2.0E-40
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 23 424 2.0E-40
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 21 424 2.0E-40
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 23 461 2.0E-40
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 21 461 2.0E-40
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 21 461 2.0E-40
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 23 424 3.0E-40
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 23 736 3.0E-40
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 23 461 3.0E-40
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 19 424 4.0E-40
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 19 424 4.0E-40
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 19 461 4.0E-40
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 23 424 6.0E-40
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 23 461 6.0E-40
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 23 424 7.0E-40
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 20 424 8.0E-40
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 23 424 8.0E-40
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 21 461 9.0E-40
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 21 461 9.0E-40
sp|Q96VB9|HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSI3 PE=1 SV=2 43 473 1.0E-39
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 23 461 1.0E-39
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 19 466 2.0E-39
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 16 424 2.0E-39
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 23 461 2.0E-39
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 23 461 2.0E-39
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 23 461 2.0E-39
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 23 461 2.0E-39
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 23 461 2.0E-39
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 23 461 2.0E-39
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 18 424 3.0E-39
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 16 424 3.0E-39
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 16 424 3.0E-39
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 16 424 3.0E-39
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 20 406 3.0E-39
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 23 461 3.0E-39
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 23 461 4.0E-39
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 16 424 4.0E-39
sp|Q03WI2|DNAK_LEUMM Chaperone protein DnaK OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dnaK PE=3 SV=1 22 410 5.0E-39
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 20 419 7.0E-39
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 20 421 8.0E-39
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 23 461 9.0E-39
sp|B1MZG6|DNAK_LEUCK Chaperone protein DnaK OS=Leuconostoc citreum (strain KM20) GN=dnaK PE=3 SV=1 22 410 9.0E-39
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 19 461 2.0E-38
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 23 400 2.0E-38
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 23 461 2.0E-38
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 23 406 2.0E-38
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 19 461 2.0E-38
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 23 461 2.0E-38
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 16 424 3.0E-38
sp|Q3IUI0|DNAK_NATPD Chaperone protein DnaK OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaK PE=3 SV=1 22 424 3.0E-38
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 19 424 4.0E-38
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 44 466 7.0E-38
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 19 461 7.0E-38
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 44 466 7.0E-38
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 20 424 8.0E-38
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 23 406 9.0E-38
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 23 461 9.0E-38
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 18 406 1.0E-37
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 20 461 1.0E-37
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 20 410 2.0E-37
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 23 461 2.0E-37
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 19 424 2.0E-37
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 20 466 2.0E-37
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 20 461 2.0E-37
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 20 421 2.0E-37
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 20 466 2.0E-37
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 20 435 2.0E-37
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 20 420 2.0E-37
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 20 421 2.0E-37
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 20 461 2.0E-37
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 19 424 3.0E-37
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 20 420 3.0E-37
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 20 461 3.0E-37
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 20 424 3.0E-37
sp|Q01100|DNAK_HALMA Chaperone protein DnaK OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaK PE=3 SV=2 22 424 3.0E-37
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 20 461 4.0E-37
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 21 424 4.0E-37
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 20 461 4.0E-37
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 23 441 4.0E-37
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 23 400 4.0E-37
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 20 466 5.0E-37
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 23 441 6.0E-37
sp|Q8EPW4|DNAK_OCEIH Chaperone protein DnaK OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaK PE=3 SV=1 22 434 7.0E-37
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 19 424 7.0E-37
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 22 410 9.0E-37
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 21 461 9.0E-37
sp|A8YVQ3|DNAK_LACH4 Chaperone protein DnaK OS=Lactobacillus helveticus (strain DPC 4571) GN=dnaK PE=3 SV=1 20 410 1.0E-36
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 20 410 1.0E-36
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 23 444 1.0E-36
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 23 461 1.0E-36
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 17 424 1.0E-36
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 16 466 1.0E-36
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 23 461 2.0E-36
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 20 420 2.0E-36
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 23 400 2.0E-36
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 20 410 2.0E-36
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 19 461 3.0E-36
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 22 410 3.0E-36
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 18 424 3.0E-36
sp|Q2RKX4|DNAK_MOOTA Chaperone protein DnaK OS=Moorella thermoacetica (strain ATCC 39073) GN=dnaK PE=3 SV=1 20 410 4.0E-36
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 19 466 4.0E-36
sp|Q05647|DNAK_ERYRH Chaperone protein DnaK OS=Erysipelothrix rhusiopathiae GN=dnaK PE=3 SV=2 22 410 4.0E-36
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 23 443 4.0E-36
sp|Q044A9|DNAK_LACGA Chaperone protein DnaK OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaK PE=3 SV=1 20 410 5.0E-36
sp|Q74IT6|DNAK_LACJO Chaperone protein DnaK OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaK PE=3 SV=1 20 410 5.0E-36
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 23 400 5.0E-36
sp|Q84BU4|DNAK_LACAC Chaperone protein DnaK OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaK PE=3 SV=1 20 410 5.0E-36
sp|Q6F149|DNAK_MESFL Chaperone protein DnaK OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=dnaK PE=3 SV=1 22 406 6.0E-36
sp|Q1WUE8|DNAK_LACS1 Chaperone protein DnaK OS=Lactobacillus salivarius (strain UCC118) GN=dnaK PE=3 SV=1 20 410 6.0E-36
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 20 410 6.0E-36
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 20 466 7.0E-36
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 22 410 8.0E-36
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 22 410 8.0E-36
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 23 441 9.0E-36
sp|Q9HRY2|DNAK_HALSA Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dnaK PE=3 SV=1 22 424 1.0E-35
sp|B0R3H4|DNAK_HALS3 Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dnaK PE=3 SV=1 22 424 1.0E-35
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 22 466 1.0E-35
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 23 461 1.0E-35
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 20 410 1.0E-35
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 18 406 2.0E-35
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 20 435 3.0E-35
sp|Q049W6|DNAK_LACDB Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaK PE=3 SV=1 20 410 3.0E-35
sp|Q1G9R2|DNAK_LACDA Chaperone protein DnaK OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaK PE=3 SV=1 20 410 3.0E-35
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 23 408 3.0E-35
sp|Q05036|YLA4_CAEEL Uncharacterized protein C30C11.4 OS=Caenorhabditis elegans GN=C30C11.4 PE=3 SV=1 21 822 3.0E-35
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 23 424 4.0E-35
sp|Q9ZEJ0|DNAK_MYCHO Chaperone protein DnaK OS=Mycoplasma hominis GN=dnaK PE=3 SV=1 22 410 4.0E-35
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 20 476 4.0E-35
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 125 410 4.0E-35
sp|Q8KML6|DNAK_LACSN Chaperone protein DnaK OS=Lactobacillus sanfranciscensis GN=dnaK PE=3 SV=1 22 410 4.0E-35
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 23 424 6.0E-35
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 20 410 6.0E-35
sp|O86103|DNAK_AQUPY Chaperone protein DnaK (Fragment) OS=Aquifex pyrophilus GN=dnaK PE=3 SV=1 16 476 7.0E-35
sp|Q9KWS7|DNAK_GEOTM Chaperone protein DnaK OS=Geobacillus thermoglucosidasius GN=dnaK PE=3 SV=3 20 410 7.0E-35
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 17 406 8.0E-35
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 23 445 8.0E-35
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 23 424 8.0E-35
sp|P0A3J4|DNAK_STRAG Chaperone protein DnaK OS=Streptococcus agalactiae GN=dnaK PE=3 SV=1 22 410 8.0E-35
sp|P0A3J3|DNAK_STRA5 Chaperone protein DnaK OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaK PE=3 SV=1 22 410 8.0E-35
sp|P0A3J2|DNAK_STRA3 Chaperone protein DnaK OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaK PE=3 SV=1 22 410 8.0E-35
sp|Q3K3T2|DNAK_STRA1 Chaperone protein DnaK OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaK PE=3 SV=1 22 410 8.0E-35
sp|C5C3P2|DNAK_BEUC1 Chaperone protein DnaK OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=dnaK PE=3 SV=1 20 424 9.0E-35
sp|B5XHZ0|DNAK_STRPZ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dnaK PE=3 SV=1 22 410 9.0E-35
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 23 445 1.0E-34
sp|A6TSM0|DNAK_ALKMQ Chaperone protein DnaK OS=Alkaliphilus metalliredigens (strain QYMF) GN=dnaK PE=3 SV=1 20 410 1.0E-34
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 18 406 1.0E-34
sp|P0C0C5|DNAK_STRPY Chaperone protein DnaK OS=Streptococcus pyogenes GN=dnaK PE=3 SV=2 22 410 1.0E-34
sp|Q48RR3|DNAK_STRPM Chaperone protein DnaK OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|A2RCW6|DNAK_STRPG Chaperone protein DnaK OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|Q1J578|DNAK_STRPF Chaperone protein DnaK OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|P68837|DNAK_STRP8 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaK PE=3 SV=2 22 410 1.0E-34
sp|Q5XAD6|DNAK_STRP6 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaK PE=1 SV=3 22 410 1.0E-34
sp|P0C0C6|DNAK_STRP1 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M1 GN=dnaK PE=3 SV=2 22 410 1.0E-34
sp|Q1JFC8|DNAK_STRPD Chaperone protein DnaK OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dnaK PE=3 SV=1 22 410 1.0E-34
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 22 424 2.0E-34
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 20 525 2.0E-34
sp|P0DB71|DNAK_STRPQ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|P0DB70|DNAK_STRP3 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|Q7VC04|DNAK1_PROMA Chaperone protein dnaK1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK1 PE=3 SV=1 22 424 2.0E-34
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 20 415 2.0E-34
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 20 424 2.0E-34
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 22 410 2.0E-34
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 20 424 2.0E-34
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 20 421 2.0E-34
sp|B9DVF3|DNAK_STRU0 Chaperone protein DnaK OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dnaK PE=3 SV=1 22 410 2.0E-34
sp|B9MJZ1|DNAK_CALBD Chaperone protein DnaK OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaK PE=3 SV=1 20 410 3.0E-34
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 22 410 4.0E-34
sp|Q05558|DNAK_STRCO Chaperone protein DnaK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaK PE=3 SV=1 20 410 4.0E-34
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 20 410 4.0E-34
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 20 410 4.0E-34
sp|Q03MR6|DNAK_STRTD Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dnaK PE=3 SV=1 22 410 4.0E-34
sp|Q5M1T8|DNAK_STRT1 Chaperone protein DnaK OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaK PE=3 SV=1 22 410 4.0E-34
sp|Q9RY23|DNAK_DEIRA Chaperone protein DnaK OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaK PE=1 SV=3 20 435 5.0E-34
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 22 410 5.0E-34
sp|Q03FR7|DNAK_PEDPA Chaperone protein DnaK OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaK PE=3 SV=1 22 410 5.0E-34
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 20 424 6.0E-34
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 23 400 6.0E-34
sp|Q71ZJ7|DNAK_LISMF Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaK PE=3 SV=3 20 410 6.0E-34
sp|C1KVC0|DNAK_LISMC Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaK PE=3 SV=1 20 410 6.0E-34
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 23 445 6.0E-34
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 22 410 6.0E-34
sp|Q3AF08|DNAK_CARHZ Chaperone protein DnaK OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaK PE=3 SV=1 22 410 6.0E-34
sp|P0DJM2|DNAK_LISMO Chaperone protein DnaK OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaK PE=3 SV=1 20 410 7.0E-34
sp|G2K046|DNAK_LISM4 Chaperone protein DnaK OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaK PE=3 SV=1 20 410 7.0E-34
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 20 410 7.0E-34
sp|Q92BN8|DNAK_LISIN Chaperone protein DnaK OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaK PE=3 SV=3 20 410 7.0E-34
sp|C1CCQ8|DNAK_STRZJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain JJA) GN=dnaK PE=3 SV=1 22 410 7.0E-34
sp|P95829|DNAK_STRPN Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaK PE=3 SV=2 22 410 7.0E-34
sp|B8ZLY9|DNAK_STRPJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dnaK PE=3 SV=1 22 410 7.0E-34
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 23 445 8.0E-34
sp|B2IMB5|DNAK_STRPS Chaperone protein DnaK OS=Streptococcus pneumoniae (strain CGSP14) GN=dnaK PE=3 SV=1 22 410 8.0E-34
sp|B8DYH6|DNAK_DICTD Chaperone protein DnaK OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=dnaK PE=3 SV=1 20 424 8.0E-34
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 20 410 8.0E-34
sp|B8DE38|DNAK_LISMH Chaperone protein DnaK OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaK PE=3 SV=1 20 410 8.0E-34
sp|B5E232|DNAK_STRP4 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dnaK PE=3 SV=1 22 410 8.0E-34
sp|C1CQ18|DNAK_STRZT Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|C1CJ06|DNAK_STRZP Chaperone protein DnaK OS=Streptococcus pneumoniae (strain P1031) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|Q8CWT3|DNAK_STRR6 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|B1IA52|DNAK_STRPI Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|C1C5N7|DNAK_STRP7 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain 70585) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|Q04LY0|DNAK_STRP2 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|C0M7T9|DNAK_STRE4 Chaperone protein DnaK OS=Streptococcus equi subsp. equi (strain 4047) GN=dnaK PE=3 SV=1 22 410 9.0E-34
sp|Q9ZEJ6|DNAK1_NOSS1 Chaperone protein dnaK1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK1 PE=3 SV=2 20 410 9.0E-34
sp|B9LUC7|DNAK_HALLT Chaperone protein DnaK OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaK PE=3 SV=1 22 424 1.0E-33
sp|B9E6X1|DNAK_MACCJ Chaperone protein DnaK OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|C0ME86|DNAK_STRS7 Chaperone protein DnaK OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|A8GMF9|DNAK_RICAH Chaperone protein DnaK OS=Rickettsia akari (strain Hartford) GN=dnaK PE=3 SV=1 22 424 1.0E-33
sp|A4XKA4|DNAK_CALS8 Chaperone protein DnaK OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaK PE=3 SV=1 20 410 1.0E-33
sp|O05714|DNAK_ANAVT Chaperone protein DnaK OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaK PE=3 SV=1 20 410 1.0E-33
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 23 445 1.0E-33
sp|Q5M6D1|DNAK_STRT2 Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaK PE=3 SV=1 22 410 1.0E-33
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 20 424 1.0E-33
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 23 410 2.0E-33
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 23 410 2.0E-33
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 22 410 2.0E-33
sp|Q826F6|DNAK2_STRAW Chaperone protein dnaK2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK2 PE=3 SV=1 20 410 2.0E-33
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 20 405 2.0E-33
sp|B1HUD1|DNAK_LYSSC Chaperone protein DnaK OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q1JKD6|DNAK_STRPC Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dnaK PE=3 SV=1 22 410 2.0E-33
sp|Q1JA83|DNAK_STRPB Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dnaK PE=3 SV=1 22 410 2.0E-33
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 23 410 2.0E-33
sp|O87777|DNAK_LACSK Chaperone protein DnaK OS=Lactobacillus sakei GN=dnaK PE=2 SV=1 20 410 2.0E-33
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 23 400 2.0E-33
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 20 410 2.0E-33
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 20 410 2.0E-33
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 22 410 2.0E-33
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 20 476 2.0E-33
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|P05646|DNAK_BACME Chaperone protein DnaK OS=Bacillus megaterium GN=dnaK PE=3 SV=3 20 410 3.0E-33
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 22 410 3.0E-33
sp|P29215|DNAK_GUITH Chaperone protein dnaK OS=Guillardia theta GN=dnaK PE=3 SV=2 22 476 3.0E-33
sp|P50022|DNAK3_SYNE7 Chaperone protein dnaK3 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK3 PE=3 SV=1 20 424 3.0E-33
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 20 410 3.0E-33
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 20 405 3.0E-33
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 20 476 3.0E-33
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 20 476 3.0E-33
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 22 406 3.0E-33
sp|Q31HA7|DNAK_THICR Chaperone protein DnaK OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaK PE=3 SV=1 22 424 3.0E-33
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 22 424 3.0E-33
sp|Q65H54|DNAK_BACLD Chaperone protein DnaK OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaK PE=3 SV=1 22 410 3.0E-33
sp|A5N6M2|DNAK_CLOK5 Chaperone protein DnaK OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaK PE=3 SV=1 22 410 4.0E-33
sp|B9E041|DNAK_CLOK1 Chaperone protein DnaK OS=Clostridium kluyveri (strain NBRC 12016) GN=dnaK PE=3 SV=1 22 410 4.0E-33
sp|Q38W93|DNAK_LACSS Chaperone protein DnaK OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaK PE=3 SV=1 20 410 4.0E-33
sp|Q6B8V2|DNAK_GRATL Chaperone protein dnaK OS=Gracilaria tenuistipitata var. liui GN=dnaK PE=3 SV=1 20 410 5.0E-33
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 22 406 5.0E-33
sp|Q8EUH7|DNAK_MYCPE Chaperone protein DnaK OS=Mycoplasma penetrans (strain HF-2) GN=dnaK PE=3 SV=1 1 435 5.0E-33
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 22 410 6.0E-33
sp|Q5N1V0|DNAK1_SYNP6 Chaperone protein DnaK 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK1 PE=3 SV=1 20 424 7.0E-33
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 20 405 7.0E-33
sp|Q7U6R7|DNAK1_SYNPX Chaperone protein dnaK1 OS=Synechococcus sp. (strain WH8102) GN=dnaK1 PE=3 SV=1 22 424 7.0E-33
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 22 406 7.0E-33
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 22 406 7.0E-33
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 17 406 7.0E-33
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 20 410 7.0E-33
sp|Q4A658|DNAK_MYCS5 Chaperone protein DnaK OS=Mycoplasma synoviae (strain 53) GN=dnaK PE=3 SV=1 22 409 7.0E-33
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 22 410 8.0E-33
sp|A9WQR3|DNAK_RENSM Chaperone protein DnaK OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=dnaK PE=3 SV=1 23 410 8.0E-33
sp|B8H6Q1|DNAK_ARTCA Chaperone protein DnaK OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=dnaK PE=3 SV=1 23 410 8.0E-33
sp|A8AVA8|DNAK_STRGC Chaperone protein DnaK OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dnaK PE=3 SV=1 22 410 9.0E-33
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 20 405 1.0E-32
sp|Q9HHB9|DNAK_HALMT Chaperone protein DnaK OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaK PE=3 SV=1 22 424 1.0E-32
sp|A0K1L3|DNAK_ARTS2 Chaperone protein DnaK OS=Arthrobacter sp. (strain FB24) GN=dnaK PE=3 SV=1 23 410 1.0E-32
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 22 431 1.0E-32
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 20 410 1.0E-32
sp|Q03QU1|DNAK_LACBA Chaperone protein DnaK OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaK PE=3 SV=1 22 410 1.0E-32
sp|O06942|DNAK_STRMU Chaperone protein DnaK OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaK PE=2 SV=2 22 410 1.0E-32
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 20 410 1.0E-32
sp|P47547|DNAK_MYCGE Chaperone protein DnaK OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaK PE=3 SV=1 22 410 1.0E-32
sp|B5YAR3|DNAK_DICT6 Chaperone protein DnaK OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|B1KZN7|DNAK_CLOBM Chaperone protein DnaK OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|C3L3G7|DNAK_CLOB6 Chaperone protein DnaK OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|Q88VM0|DNAK_LACPL Chaperone protein DnaK OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaK PE=3 SV=1 112 410 2.0E-32
sp|A7GHH6|DNAK_CLOBL Chaperone protein DnaK OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|C1FVU0|DNAK_CLOBJ Chaperone protein DnaK OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|A5I640|DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|A7FXL5|DNAK_CLOB1 Chaperone protein DnaK OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|Q07US6|DNAK_RHOP5 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|P48741|HSP77_HUMAN Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2 23 369 2.0E-32
sp|Q82EX9|DNAK1_STRAW Chaperone protein dnaK1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK1 PE=3 SV=1 20 410 2.0E-32
sp|A4X148|DNAK_SALTO Chaperone protein DnaK OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|Q21CI2|DNAK_RHOPB Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=3 SV=1 20 424 2.0E-32
sp|B1ILM3|DNAK_CLOBK Chaperone protein DnaK OS=Clostridium botulinum (strain Okra / Type B1) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 23 466 2.0E-32
sp|C0ZB48|DNAK_BREBN Chaperone protein DnaK OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|P26823|DNAK_CLOPE Chaperone protein DnaK OS=Clostridium perfringens (strain 13 / Type A) GN=dnaK PE=3 SV=2 22 410 2.0E-32
sp|Q0TNS7|DNAK_CLOP1 Chaperone protein DnaK OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dnaK PE=3 SV=1 22 410 2.0E-32
sp|B0S1F8|DNAK_FINM2 Chaperone protein DnaK OS=Finegoldia magna (strain ATCC 29328) GN=dnaK PE=3 SV=1 20 410 2.0E-32
sp|Q6MT06|DNAK_MYCMS Chaperone protein DnaK OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaK PE=3 SV=1 22 406 3.0E-32
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 20 424 3.0E-32
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 125 410 3.0E-32
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 22 474 3.0E-32
sp|Q2SSB0|DNAK_MYCCT Chaperone protein DnaK OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaK PE=3 SV=1 22 406 3.0E-32
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|Q12WE6|DNAK_METBU Chaperone protein DnaK OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dnaK PE=3 SV=1 22 424 3.0E-32
sp|Q0SRE3|DNAK_CLOPS Chaperone protein DnaK OS=Clostridium perfringens (strain SM101 / Type A) GN=dnaK PE=3 SV=1 22 410 3.0E-32
sp|Q54215|DNAK_STRGR Chaperone protein DnaK OS=Streptomyces griseus GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 20 410 3.0E-32
sp|Q1QRU1|DNAK_NITHX Chaperone protein DnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=3 SV=1 20 424 3.0E-32
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 20 525 3.0E-32
sp|Q3BVB8|DNAK_XANC5 Chaperone protein DnaK OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 20 406 4.0E-32
sp|B5ZBE9|DNAK_UREU1 Chaperone protein DnaK OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=dnaK PE=3 SV=1 22 474 4.0E-32
sp|Q8PMB0|DNAK_XANAC Chaperone protein DnaK OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 20 410 4.0E-32
sp|Q2J320|DNAK_RHOP2 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=3 SV=1 22 424 4.0E-32
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 23 408 4.0E-32
sp|A4VT29|DNAK_STRSY Chaperone protein DnaK OS=Streptococcus suis (strain 05ZYH33) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|A4VZB5|DNAK_STRS2 Chaperone protein DnaK OS=Streptococcus suis (strain 98HAH33) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|Q8G6W1|DNAK_BIFLO Chaperone protein DnaK OS=Bifidobacterium longum (strain NCC 2705) GN=dnaK PE=3 SV=1 20 400 4.0E-32
sp|B3DNP9|DNAK_BIFLD Chaperone protein DnaK OS=Bifidobacterium longum (strain DJO10A) GN=dnaK PE=3 SV=1 20 400 4.0E-32
sp|A3CQC2|DNAK_STRSV Chaperone protein DnaK OS=Streptococcus sanguinis (strain SK36) GN=dnaK PE=3 SV=1 22 410 4.0E-32
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 20 525 4.0E-32
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 20 525 4.0E-32
sp|A7MWW0|DNAK_VIBCB Chaperone protein DnaK OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaK PE=3 SV=1 20 410 5.0E-32
sp|Q87RX3|DNAK_VIBPA Chaperone protein DnaK OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaK PE=3 SV=1 20 410 5.0E-32
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 20 525 5.0E-32
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 22 435 5.0E-32
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 22 410 5.0E-32
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 22 410 5.0E-32
sp|P20583|HSP71_TRYCR Heat shock 70 kDa protein, mitochondrial OS=Trypanosoma cruzi GN=MTP70 PE=3 SV=1 18 461 5.0E-32
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 20 408 6.0E-32
sp|B1VMF3|DNAK_STRGG Chaperone protein DnaK OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=dnaK PE=3 SV=1 20 410 6.0E-32
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 22 410 6.0E-32
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 22 435 6.0E-32
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 22 410 7.0E-32
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 22 474 7.0E-32
sp|C4K3I6|DNAK_HAMD5 Chaperone protein DnaK OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaK PE=3 SV=1 22 410 8.0E-32
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 20 525 8.0E-32
sp|B7GT47|DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=dnaK PE=3 SV=1 20 400 8.0E-32
sp|Q72IK5|DNAK_THET2 Chaperone protein DnaK OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaK PE=3 SV=1 20 461 8.0E-32
sp|Q6KIH7|DNAK_MYCMO Chaperone protein DnaK OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaK PE=3 SV=1 22 424 8.0E-32
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 22 525 8.0E-32
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 22 525 8.0E-32
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|A4IX28|DNAK_FRATW Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|Q8PAK9|DNAK_XANCP Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|B0RVU2|DNAK_XANCB Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|Q4UT11|DNAK_XANC8 Chaperone protein DnaK OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaK PE=3 SV=1 22 410 1.0E-31
sp|B1YKS9|DNAK_EXIS2 Chaperone protein DnaK OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaK PE=3 SV=1 20 410 1.0E-31
sp|A9KKU0|DNAK_CLOPH Chaperone protein DnaK OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaK PE=3 SV=1 22 424 1.0E-31
sp|Q56235|DNAK_THET8 Chaperone protein DnaK OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaK PE=3 SV=2 20 461 1.0E-31
sp|Q13E60|DNAK_RHOPS Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=3 SV=1 22 424 1.0E-31
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 22 424 1.0E-31
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 20 405 2.0E-31
sp|Q1IF59|DNAK_PSEE4 Chaperone protein DnaK OS=Pseudomonas entomophila (strain L48) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q1IT15|DNAK_KORVE Chaperone protein DnaK OS=Koribacter versatilis (strain Ellin345) GN=dnaK PE=3 SV=1 20 461 2.0E-31
sp|P48205|DNAK_FRATU Chaperone protein DnaK OS=Francisella tularensis GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|B2SQU4|DNAK_XANOP Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q2P459|DNAK_XANOM Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 20 424 2.0E-31
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|A3M8W9|DNAK_ACIBT Chaperone protein DnaK OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaK PE=3 SV=2 20 406 2.0E-31
sp|B2HZZ7|DNAK_ACIBC Chaperone protein DnaK OS=Acinetobacter baumannii (strain ACICU) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|B8FUN4|DNAK_DESHD Chaperone protein DnaK OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q67S54|DNAK_SYMTH Chaperone protein DnaK OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 22 420 2.0E-31
sp|B0V5U4|DNAK_ACIBY Chaperone protein DnaK OS=Acinetobacter baumannii (strain AYE) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|B7IBK5|DNAK_ACIB5 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB0057) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|B7H317|DNAK_ACIB3 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaK PE=3 SV=1 20 406 2.0E-31
sp|Q5H186|DNAK_XANOR Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 20 410 2.0E-31
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 20 424 2.0E-31
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 20 424 2.0E-31
sp|Q5NFG7|DNAK_FRATT Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|Q14GW9|DNAK_FRAT1 Chaperone protein DnaK OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaK PE=3 SV=1 22 410 2.0E-31
sp|A1A3P5|DNAK_BIFAA Chaperone protein DnaK OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=dnaK PE=3 SV=1 23 400 3.0E-31
sp|Q4A8U5|DNAK_MYCH7 Chaperone protein DnaK OS=Mycoplasma hyopneumoniae (strain 7448) GN=dnaK PE=3 SV=1 22 409 3.0E-31
sp|A0Q7F0|DNAK_FRATN Chaperone protein DnaK OS=Francisella tularensis subsp. novicida (strain U112) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 20 405 3.0E-31
sp|Q0BLK4|DNAK_FRATO Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|Q2A328|DNAK_FRATH Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|A7NCM9|DNAK_FRATF Chaperone protein DnaK OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 22 482 3.0E-31
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 22 410 3.0E-31
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 22 406 3.0E-31
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 22 410 3.0E-31
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 22 406 4.0E-31
sp|Q634M7|DNAK_BACCZ Chaperone protein DnaK OS=Bacillus cereus (strain ZK / E33L) GN=dnaK PE=3 SV=1 22 406 4.0E-31
sp|Q818E9|DNAK_BACCR Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dnaK PE=3 SV=1 22 406 4.0E-31
sp|B7HCU0|DNAK_BACC4 Chaperone protein DnaK OS=Bacillus cereus (strain B4264) GN=dnaK PE=3 SV=1 22 406 4.0E-31
sp|C1ESK8|DNAK_BACC3 Chaperone protein DnaK OS=Bacillus cereus (strain 03BB102) GN=dnaK PE=3 SV=1 22 406 4.0E-31
sp|Q5ZLK7|HYOU1_CHICK Hypoxia up-regulated protein 1 OS=Gallus gallus GN=HYOU1 PE=2 SV=1 565 828 3.0E-12
sp|Q556U6|BIP1_DICDI Luminal-binding protein 1 OS=Dictyostelium discoideum GN=bip1-1 PE=3 SV=1 609 707 1.0E-06
sp|O74225|HSP88_NEUCR Heat shock protein hsp88 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp88 PE=1 SV=1 636 739 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0044183 protein folding chaperone No
GO:0000166 nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|781450
MRLTRVWSALALLAPLAVEASVLAIDYGADYMKASLMKPGTPFDVLLNKDSKRKIQSVVGWKKSDRVFGGDAFNL
ASRFPSDVFIDTKILQAVPYDSDTVSFYKKISSADVIESSRGAVAFKQSDEKEWTVEELVAMQLAYVKDLAESFA
QEKVRDVVVAVPPYYTQFERDAIVDAIEISGLKTLALINDGTAVAVNYAMTRTFDEAPEYHIFYDAGASSIAATV
VAFSSTTDKKEGAGTQVSVAGVGWDRNVAGLELDRRLREILVRAFEEKHHKSLRQDKKGMTKLWKEASRVKSILS
ANSEATSSVESLAYNIDFKTKVTRAAFEEACKDLQPRFVQPIFDALLSAGLSMNDISSVVFTGGATRTPMVQAAV
KKVVGEDKMAFNVNADESIVLGAALYGASLSRQFKTKNIKVNDLTVYDLQASYAAAPTSPDAKPRTITTLVFPAG
SKTGTKKTLTFKRKEDFTINLDYRDLGDSGFPSRMLEADIVGVAEAIANLTERGAIDPVVKATLTLSESGFFSVS
DAVAFGEIKDDSITGKLKGLFAGSSSADETSTGSAENTPPRETPETAETVSSSSSSSASSSADTPESTTKVVEEK
KKAPVENTIPLTVNVRFTTISPMTVEEKQQSRKKLRAVDQEEAIKTRREEARNTFESYLYRLRDLLDDESAETPF
KKCSRETEREALATRLDESFQWLFDRGDIADTTHFLDKRIALETLEKPIIHRYKEIEAFPEALNNSQKWNFHTRI
FLTEARQNLTLESEAGLPSKWTFEELDGLEKTLKDHEKWLNEWVEKQRSVKSFEDPVIETMEMKARAKTLETQLF
KLVKRKVPKTKKPVKKDEPEASGTSSVKEDAKSTTTTTPTSTTTPDMKEEKKNGDDSRTRDEL*
Coding >Agabi119p4|781450
ATGCGATTAACACGAGTTTGGAGTGCTCTGGCCCTCCTTGCACCTCTAGCCGTAGAAGCCTCCGTACTCGCTATC
GACTATGGCGCGGATTACATGAAGGCATCATTGATGAAGCCTGGCACGCCGTTCGACGTCCTCTTGAACAAGGAC
TCGAAGAGAAAAATTCAGTCTGTTGTAGGCTGGAAGAAGTCGGATCGGGTATTTGGTGGTGACGCATTCAACCTC
GCATCGAGATTTCCTAGTGACGTCTTCATCGACACCAAAATACTTCAGGCCGTCCCATACGACTCTGACACTGTT
TCTTTCTACAAGAAAATATCCAGTGCGGACGTGATAGAGAGTTCTCGTGGAGCTGTTGCTTTTAAACAGAGCGAC
GAAAAAGAATGGACAGTCGAAGAACTTGTCGCCATGCAACTTGCCTATGTCAAGGACCTCGCGGAGTCGTTTGCT
CAGGAAAAAGTCCGAGACGTTGTCGTGGCTGTCCCCCCATACTATACACAATTCGAGCGTGATGCCATCGTCGAC
GCTATCGAGATTTCCGGTCTGAAGACTCTTGCTCTTATTAATGATGGAACGGCAGTAGCCGTCAACTACGCTATG
ACGAGGACCTTCGATGAAGCACCAGAGTACCACATCTTCTATGACGCCGGAGCATCGTCAATTGCCGCGACCGTT
GTTGCGTTCTCAAGTACAACCGATAAAAAGGAAGGTGCTGGCACTCAAGTATCCGTCGCTGGCGTTGGCTGGGAT
CGTAATGTCGCCGGATTGGAGTTGGATAGGCGGCTAAGGGAGATTTTGGTCCGGGCTTTCGAAGAGAAGCATCAC
AAGAGTTTGCGGCAGGACAAGAAGGGTATGACGAAGCTTTGGAAAGAAGCAAGTCGTGTCAAAAGCATCCTCAGT
GCCAACTCAGAGGCCACTTCCTCGGTGGAATCTCTGGCCTACAATATCGATTTCAAGACCAAAGTCACTCGGGCG
GCATTTGAAGAAGCATGTAAAGATCTTCAACCCCGTTTCGTTCAGCCAATCTTCGACGCGCTCCTTTCTGCTGGG
CTCAGTATGAATGACATTTCGTCTGTGGTCTTCACTGGTGGAGCCACGAGAACGCCTATGGTTCAAGCCGCCGTC
AAAAAAGTTGTTGGCGAGGATAAAATGGCTTTCAACGTGAACGCTGATGAATCGATAGTGTTGGGTGCGGCCCTA
TATGGTGCTTCGCTCAGCCGGCAGTTCAAGACCAAGAACATTAAAGTCAACGATCTCACCGTGTATGACCTTCAG
GCATCGTATGCTGCTGCTCCAACTTCACCTGACGCGAAACCGAGAACTATAACGACTCTCGTATTCCCCGCTGGA
TCCAAAACCGGTACCAAGAAGACATTGACCTTCAAGAGGAAGGAAGATTTTACCATTAATCTCGATTATCGTGAC
CTTGGTGACTCGGGTTTCCCTTCTCGTATGCTGGAGGCCGATATTGTTGGCGTTGCTGAGGCTATCGCGAACCTC
ACTGAGCGCGGAGCAATCGATCCTGTCGTCAAAGCAACTCTTACACTCTCCGAATCTGGCTTTTTCAGTGTTTCC
GATGCTGTCGCCTTTGGCGAAATCAAGGATGATAGTATCACTGGAAAGTTAAAGGGACTCTTCGCTGGAAGCAGC
TCAGCAGACGAAACGTCTACTGGATCTGCGGAAAATACGCCACCTAGGGAGACTCCTGAAACCGCGGAAACCGTT
TCTTCATCGTCGTCGTCGTCAGCGTCGTCATCAGCTGATACCCCCGAGTCTACGACCAAGGTGGTGGAAGAAAAG
AAGAAGGCTCCTGTCGAAAACACAATCCCCCTCACTGTTAACGTCAGGTTTACGACAATATCTCCGATGACTGTC
GAGGAGAAACAACAGTCCAGGAAAAAGCTTCGTGCTGTTGACCAAGAAGAAGCTATCAAGACTCGCCGCGAAGAA
GCTCGTAATACTTTCGAGAGCTACCTTTACCGTCTTCGCGATCTTTTGGACGACGAAAGTGCCGAGACGCCGTTC
AAGAAATGTTCAAGAGAAACCGAACGCGAGGCCCTCGCTACCCGGCTGGATGAATCTTTCCAATGGCTCTTCGAC
CGTGGTGATATAGCCGACACGACTCATTTCCTCGATAAACGTATAGCACTCGAAACACTCGAGAAACCAATCATT
CATCGTTACAAAGAAATCGAAGCCTTCCCAGAAGCGTTGAACAACTCCCAAAAATGGAATTTCCATACCCGTATA
TTCTTAACCGAAGCTAGGCAAAATCTTACTCTCGAATCTGAAGCCGGTTTACCCTCGAAATGGACTTTCGAAGAA
CTTGATGGTCTAGAGAAGACTTTGAAAGATCATGAGAAGTGGTTGAATGAGTGGGTAGAAAAACAGCGCTCTGTG
AAGAGTTTTGAGGATCCTGTTATTGAAACTATGGAGATGAAAGCTAGAGCCAAAACTCTGGAAACGCAGTTGTTC
AAGTTGGTGAAGAGGAAGGTGCCGAAGACGAAGAAGCCAGTGAAGAAGGATGAACCGGAGGCGAGTGGTACCAGT
AGTGTGAAAGAGGATGCAAAATCCACTACTACTACGACGCCAACATCGACGACGACACCAGATATGAAGGAGGAG
AAGAAGAATGGTGATGATTCGAGGACGCGTGATGAACTGTAG
Transcript >Agabi119p4|781450
ATGCGATTAACACGAGTTTGGAGTGCTCTGGCCCTCCTTGCACCTCTAGCCGTAGAAGCCTCCGTACTCGCTATC
GACTATGGCGCGGATTACATGAAGGCATCATTGATGAAGCCTGGCACGCCGTTCGACGTCCTCTTGAACAAGGAC
TCGAAGAGAAAAATTCAGTCTGTTGTAGGCTGGAAGAAGTCGGATCGGGTATTTGGTGGTGACGCATTCAACCTC
GCATCGAGATTTCCTAGTGACGTCTTCATCGACACCAAAATACTTCAGGCCGTCCCATACGACTCTGACACTGTT
TCTTTCTACAAGAAAATATCCAGTGCGGACGTGATAGAGAGTTCTCGTGGAGCTGTTGCTTTTAAACAGAGCGAC
GAAAAAGAATGGACAGTCGAAGAACTTGTCGCCATGCAACTTGCCTATGTCAAGGACCTCGCGGAGTCGTTTGCT
CAGGAAAAAGTCCGAGACGTTGTCGTGGCTGTCCCCCCATACTATACACAATTCGAGCGTGATGCCATCGTCGAC
GCTATCGAGATTTCCGGTCTGAAGACTCTTGCTCTTATTAATGATGGAACGGCAGTAGCCGTCAACTACGCTATG
ACGAGGACCTTCGATGAAGCACCAGAGTACCACATCTTCTATGACGCCGGAGCATCGTCAATTGCCGCGACCGTT
GTTGCGTTCTCAAGTACAACCGATAAAAAGGAAGGTGCTGGCACTCAAGTATCCGTCGCTGGCGTTGGCTGGGAT
CGTAATGTCGCCGGATTGGAGTTGGATAGGCGGCTAAGGGAGATTTTGGTCCGGGCTTTCGAAGAGAAGCATCAC
AAGAGTTTGCGGCAGGACAAGAAGGGTATGACGAAGCTTTGGAAAGAAGCAAGTCGTGTCAAAAGCATCCTCAGT
GCCAACTCAGAGGCCACTTCCTCGGTGGAATCTCTGGCCTACAATATCGATTTCAAGACCAAAGTCACTCGGGCG
GCATTTGAAGAAGCATGTAAAGATCTTCAACCCCGTTTCGTTCAGCCAATCTTCGACGCGCTCCTTTCTGCTGGG
CTCAGTATGAATGACATTTCGTCTGTGGTCTTCACTGGTGGAGCCACGAGAACGCCTATGGTTCAAGCCGCCGTC
AAAAAAGTTGTTGGCGAGGATAAAATGGCTTTCAACGTGAACGCTGATGAATCGATAGTGTTGGGTGCGGCCCTA
TATGGTGCTTCGCTCAGCCGGCAGTTCAAGACCAAGAACATTAAAGTCAACGATCTCACCGTGTATGACCTTCAG
GCATCGTATGCTGCTGCTCCAACTTCACCTGACGCGAAACCGAGAACTATAACGACTCTCGTATTCCCCGCTGGA
TCCAAAACCGGTACCAAGAAGACATTGACCTTCAAGAGGAAGGAAGATTTTACCATTAATCTCGATTATCGTGAC
CTTGGTGACTCGGGTTTCCCTTCTCGTATGCTGGAGGCCGATATTGTTGGCGTTGCTGAGGCTATCGCGAACCTC
ACTGAGCGCGGAGCAATCGATCCTGTCGTCAAAGCAACTCTTACACTCTCCGAATCTGGCTTTTTCAGTGTTTCC
GATGCTGTCGCCTTTGGCGAAATCAAGGATGATAGTATCACTGGAAAGTTAAAGGGACTCTTCGCTGGAAGCAGC
TCAGCAGACGAAACGTCTACTGGATCTGCGGAAAATACGCCACCTAGGGAGACTCCTGAAACCGCGGAAACCGTT
TCTTCATCGTCGTCGTCGTCAGCGTCGTCATCAGCTGATACCCCCGAGTCTACGACCAAGGTGGTGGAAGAAAAG
AAGAAGGCTCCTGTCGAAAACACAATCCCCCTCACTGTTAACGTCAGGTTTACGACAATATCTCCGATGACTGTC
GAGGAGAAACAACAGTCCAGGAAAAAGCTTCGTGCTGTTGACCAAGAAGAAGCTATCAAGACTCGCCGCGAAGAA
GCTCGTAATACTTTCGAGAGCTACCTTTACCGTCTTCGCGATCTTTTGGACGACGAAAGTGCCGAGACGCCGTTC
AAGAAATGTTCAAGAGAAACCGAACGCGAGGCCCTCGCTACCCGGCTGGATGAATCTTTCCAATGGCTCTTCGAC
CGTGGTGATATAGCCGACACGACTCATTTCCTCGATAAACGTATAGCACTCGAAACACTCGAGAAACCAATCATT
CATCGTTACAAAGAAATCGAAGCCTTCCCAGAAGCGTTGAACAACTCCCAAAAATGGAATTTCCATACCCGTATA
TTCTTAACCGAAGCTAGGCAAAATCTTACTCTCGAATCTGAAGCCGGTTTACCCTCGAAATGGACTTTCGAAGAA
CTTGATGGTCTAGAGAAGACTTTGAAAGATCATGAGAAGTGGTTGAATGAGTGGGTAGAAAAACAGCGCTCTGTG
AAGAGTTTTGAGGATCCTGTTATTGAAACTATGGAGATGAAAGCTAGAGCCAAAACTCTGGAAACGCAGTTGTTC
AAGTTGGTGAAGAGGAAGGTGCCGAAGACGAAGAAGCCAGTGAAGAAGGATGAACCGGAGGCGAGTGGTACCAGT
AGTGTGAAAGAGGATGCAAAATCCACTACTACTACGACGCCAACATCGACGACGACACCAGATATGAAGGAGGAG
AAGAAGAATGGTGATGATTCGAGGACGCGTGATGAACTGTAG
Gene >Agabi119p4|781450
ATGCGATTAACACGAGTTTGGAGTGCTCTGGCCCTCCTTGCACCTCTAGCCGTAGAAGCCTCCGTACTCGCTATC
GACTATGGCGCGGATTACATGAAGGCATCATTGATGAAGCCTGGCACGCCGTTCGACGTCCTCTTGAACAAGGAC
TCGAAGAGAAAAATTCAGTCTGTTGTAGGCTGGAAGAAGTCGGATCGGGTATTTGGTGGTGACGCATTCAACCTC
GTACGCCTCTTCTCTCCCCTTTATCATTTATTTAGTAAATAACCTTATTATAGGCATCGAGATTTCCTAGTGACG
TCTTCATCGACACCAAAATACTTCAGGCCGTCCCATACGACTCTGACACTGTTTCTTTCTACAAGAAAATATCCA
GTGCGGACGTGATAGAGAGTTCTCGTGGAGCTGTTGCTTTTAAACAGAGCGACGAAAAAGAATGGACAGTCGAAG
AACTTGTCGCCATGCAACTTGCCTATGTCAAGGACCTCGCGGAGTCGTTTGCTCAGGAAAAAGTCCGAGACGTTG
TCGTGGCTGTCCCCCCATACTATACACAATTCGAGCGTGATGCCATCGTCGACGCTATCGAGATTTCCGGTCTGA
AGACTCTTGCTCTTATTAATGATGGAACGGCAGTAGCCGTCAACTACGCTATGACGAGGACCTTCGATGAAGCAC
CAGAGTACCACATCTTCTATGACGCCGGAGCATCGTCAATTGCCGCGACCGTTGTTGCGTTCTCAAGTACAACCG
ATAAAAAGGAAGGTGCTGGCACTCAAGTATCCGTCGCTGGCGTTGGCTGGGATCGTAATGTCGCCGGATTGGAGT
TGGATAGGCGGCTAAGGGAGATTTTGGTCCGGGCTTTCGAAGAGAAGCATCACAAGAGTTTGCGGCAGGACAAGA
AGGGTATGACGAAGCTTTGGAAAGAAGCAAGTCGTGTCAAAAGCATCCTCAGTGCCAACTCAGAGGCCACTTCCT
CGGTGGAATCTCTGGCCTACAATATCGATTTCAAGACCAAAGTCACTCGGGCGGCATTTGAAGAAGCATGTAAAG
ATCTTCAACCCCGTTTCGTTCAGCCAATCTTCGACGCGCTCCTTTCTGCTGGGCTCAGTATGAATGACATTTCGT
CTGTGGTCTTCACTGGTGGAGCCACGAGAACGCCTATGGTTCAAGCCGCCGTCAAAAAAGTTGTTGGCGAGGATA
AAATGGCTTTCAACGTGAACGCTGATGAATCGATAGTGTTGGGTGCGGCCCTATATGGTGCTTCGCTCAGCCGGC
AGTTCAAGACCAAGAACATTAAAGTCAACGATCTCACCGTGTATGACCTTCAGGCATCGTATGCTGCTGCTCCAA
CTTCACCTGACGCGAAACCGAGAACTATAACGACTCTCGTATTCCCCGCTGGATCCAAAACCGGTACCAAGAAGA
CATTGACCTTCAAGAGGAAGGAAGATTTTACCATTAATCTCGATTATCGTGACCTTGGTGACTCGTCAGTGACCA
ATTCTACCTTGTTGTGTCACATTTTGCTAACACTTGTAAAGGGGTTTCCCTTCTCGTATGCTGGAGGCCGATATT
GTTGGCGTTGCTGAGGCTATCGCGAACCTCACTGAGCGCGGAGCAATCGATCCTGTCGTCAAAGCAACTCTTACA
CTCTCCGAATCTGGCTTTTTCAGTGTTTCCGATGCTGTCGCCTTTGGCGAAATCAAGGATGATAGTATCACTGGT
GAGTACACGTGGTGCATATTAGGAGTTGGAATAACGACTGATGTGAAATTTTCAGGAAAGTTAAAGGGACTCTTC
GCTGGAAGCAGCTCAGCAGACGAAACGTCTACTGGATCTGCGGAAAATACGCCACCTAGGGAGACTCCTGAAACC
GCGGAAACCGTTTCTTCATCGTCGTCGTCGTCAGCGTCGTCATCAGCTGATACCCCCGAGTCTACGACCAAGGTG
GTGGAAGAAAAGAAGAAGGCTCCTGTCGAAAACACAATCCCCCTCACTGTTAACGTCAGGTTTACGACAATATCT
CCGATGACTGTCGAGGAGAAACAACAGTCCAGGAAAAAGTTAGTATCTTGACTTTCTTCGGTTTGTCGTATTCAT
TTTCTTTCTTTTAAGGCTTCGTGCTGTTGACCAAGAAGAAGCTATCAAGACTCGCCGCGAAGAAGCTCGTAATAC
TTTCGAGAGCTACCTTTACCGTCTTCGCGATCTTTTGGACGACGAAAGTGCCGAGACGCCGTTCAAGAAATGTTC
AAGAGAAACCGAACGCGAGGCCCTCGCTACCCGGCTGGATGAATCTTTCCAATGGCTCTTCGACCGTGGTGATAT
AGCCGACACGACTCATTTCCTCGATAAACGTATAGCACTCGAGTAGGCCTCCTTTCATATTCATGAGTTCATTAT
GTTGATTAACTCTATTTCAGAACACTCGAGAAACCAATCATTCATCGTTACAAAGAAATCGAAGCCTTCCCAGAA
GCGTTGAACAACTCCCAAAAATGGAATTTCCATACCCGTATATTCTTAACCGAAGCTAGGCAAAATCTTACTCTC
GAATCTGAAGCCGGTTTACCCTCGAAATGGACTTTCGAAGAACTTGATGGTCTAGAGAAGACTTTGAAAGATCAT
GAGAAGTGGTTGAATGAGTGGGTAGAAAAACAGCGCTCTGTGAAGAGTTTTGAGGATCCTGTTATTGAAACTATG
GAGATGAAAGCTAGAGCCAAAACTCTGGAAACGCAGTTGTTCAAGTTGGTGAAGAGGAAGGTGCCGAAGACGAAG
AAGCCAGTGAAGAAGGATGAACCGGAGGCGAGTGGTACCAGTAGTGTGAAAGAGGATGCAAAATCCACTACTACT
ACGACGCCAACATCGACGACGACACCAGATATGAAGGAGGAGAAGAAGAATGGTGATGATTCGAGGACGCGTGAT
GAACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail