Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|780100
Gene name
Locationscaffold_13:64226..67322
Strand+
Gene length (bp)3096
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 4.8E-34 700 805
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.5E-30 674 774
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 2.3E-24 450 611
PF17921 Integrase_H2C2 Integrase zinc binding domain 3.7E-20 919 977

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 370 1023 9.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 370 1023 8.0E-124
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 370 1023 9.0E-124
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 370 1023 9.0E-124
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 370 1023 9.0E-124
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 370 1023 9.0E-124
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 370 1023 1.0E-123
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 370 1023 2.0E-123
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 370 1023 2.0E-123
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 394 1023 1.0E-98
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 394 1023 1.0E-97
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 407 1002 4.0E-82
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 384 989 1.0E-77
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 385 825 7.0E-75
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 407 1023 1.0E-72
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 385 825 6.0E-60
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 398 825 1.0E-48
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 398 825 1.0E-48
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 351 825 3.0E-48
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 398 825 6.0E-48
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 398 825 5.0E-47
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 398 825 3.0E-45
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 351 823 2.0E-44
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 422 825 2.0E-39
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 414 825 2.0E-33
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 415 873 3.0E-32
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 405 759 9.0E-32
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 407 759 2.0E-31
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 414 825 2.0E-31
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 456 820 4.0E-31
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 403 838 7.0E-31
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 403 838 9.0E-31
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 406 867 9.0E-31
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 405 759 1.0E-29
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 398 836 2.0E-29
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 470 815 2.0E-29
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 399 738 3.0E-29
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 405 745 1.0E-28
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 399 738 2.0E-27
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 399 738 7.0E-27
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 399 738 7.0E-27
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 399 738 8.0E-27
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 399 738 2.0E-26
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 399 738 2.0E-26
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 399 738 2.0E-26
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 399 738 3.0E-26
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 398 738 4.0E-26
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 399 738 6.0E-26
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 399 738 1.0E-25
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 452 826 2.0E-25
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 371 842 2.0E-24
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 414 798 2.0E-21
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 445 653 7.0E-19
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 458 553 1.0E-18
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 581 700 6.0E-16
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 413 669 3.0E-14
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 413 669 8.0E-14
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 413 669 8.0E-14
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 380 665 3.0E-13
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 380 665 4.0E-13
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 413 671 9.0E-13
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 380 665 2.0E-12
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 413 669 4.0E-12
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 413 665 1.0E-11
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 413 649 1.0E-11
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 413 670 2.0E-11
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 406 649 3.0E-11
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 387 643 3.0E-11
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 413 649 4.0E-11
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 386 647 6.0E-11
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 413 649 1.0E-10
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 413 649 1.0E-10
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 386 647 2.0E-10
sp|P03361|POL_BLVJ Pol polyprotein OS=Bovine leukemia virus (isolate Japanese BLV-1) GN=pol PE=3 SV=1 410 643 3.0E-10
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 386 647 3.0E-10
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 438 647 4.0E-10
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 413 649 4.0E-10
sp|P05962|POL_HV2NZ Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate NIH-Z) GN=gag-pol PE=3 SV=3 386 647 5.0E-10
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 386 647 6.0E-10
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 413 649 6.0E-10
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 415 662 9.0E-10
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 384 643 9.0E-10
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 386 647 1.0E-09
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 413 649 1.0E-09
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 413 669 1.0E-09
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 413 649 2.0E-09
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 399 647 4.0E-09
sp|Q76634|POL_HV2UC Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) GN=gag-pol PE=3 SV=3 399 647 5.0E-09
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 386 647 6.0E-09
sp|P25059|POL_BLVAU Pol polyprotein OS=Bovine leukemia virus (isolate Australian) GN=pol PE=3 SV=1 410 643 1.0E-08
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 384 619 2.0E-08
sp|P05897|POL_SIVMK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate K6W) GN=gag-pol PE=1 SV=2 386 647 2.0E-08
sp|P05896|POL_SIVM1 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate Mm142-83) GN=gag-pol PE=1 SV=2 401 647 2.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 632 744 7.0E-08
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 413 666 9.0E-08
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 2 96 1.0E-07
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 909 1023 1.0E-07
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 900 1023 2.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 413 585 3.0E-07
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 399 647 3.0E-07
sp|P63128|POK9_HUMAN Endogenous retrovirus group K member 9 Pol protein OS=Homo sapiens GN=ERVK-9 PE=3 SV=3 413 551 6.0E-07
sp|P35956|POL_VILVK Pol polyprotein OS=Maedi visna virus (strain KV1772) GN=pol PE=1 SV=1 380 654 6.0E-07
sp|P23427|POL_VILV2 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=pol PE=3 SV=1 380 654 7.0E-07
sp|P03370|POL_VILV Pol polyprotein OS=Maedi visna virus (strain 1514) GN=pol PE=3 SV=1 380 654 7.0E-07
sp|P16901|POL_OMVVS Pol polyprotein OS=Ovine maedi visna related virus (strain South Africa) GN=pol PE=3 SV=1 399 596 7.0E-07
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 909 1020 8.0E-07
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 399 666 8.0E-07
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 399 653 8.0E-07
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 2 96 9.0E-07
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 399 653 9.0E-07
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 399 647 1.0E-06
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 887 1020 2.0E-06
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 909 1020 2.0E-06
sp|P23426|POL_VILV1 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS1) GN=pol PE=3 SV=1 399 654 2.0E-06
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 399 666 2.0E-06
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 399 666 3.0E-06
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 399 647 3.0E-06
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 399 647 4.0E-06
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 399 666 9.0E-06
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 399 666 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|780100
MFMDKAFAEEEGFKLEPLERPIPVKNVDGTINASGAVTHRVAANVYYKGHKERVHFEICGLGKNKVILGMPWLQM
HNPEIDWEKGEVKMTRCPDGCGYKDKGKAKEKQEEIRKVEKPRKSTRQLMKEAREEEKREKPDMSHKQYAGWKLI
SFPKKSSWGTVLQYRCEECGTQTSEHLLSKHKCPAIEEIALDEFGMPYEGSDDEEEGPTMAKIEAYEKEQEEIRD
EEDRFERVNKAIGRFTQPKNIIEGIALGVEAAFARELARNRRANGGAEGLAQQSKEKAEGWAQSPGDVADRLNGD
KAERLEEDSIKTATAGKAEAGQVRPKRISAQKKNRSREEEEQLETWVRGMTEEMPEEEEIRSIDSVEQMVPKRFH
KFLKVFKQKESERMPTRKPWDHAIELKEGFKPKKGKIYPLSPNEREEVQAFVKDQLRKGYIRPSKSPQTSPVFFV
PKKDGKKRMVQDYRFLNDWTIKNNYPLPLISELIDTMGSKRLFSKIDLRWGYNNIRIKEGDEWKAAFTTFMGAFE
PTVMFFGLTNSPATFQTMMNELFRDLVNTGKVAVFIDDILIGTDDEEEHDKVVEEVLQRLMDNDLFAKPEKCEWK
RSEMGFLGCIIGRNGIKMEERKVKDVVEWPTPKCVKDVQKFLGLANYYRRFIEKFASIAKPLHALTKKDKKWSWG
DEEEEAFGALKAKFTSHPILVAPELDKELKVESDASAYATGGELSMKCEDGKWRPVAYISKSMTETERNYDIHDR
EMLGIMRCLEEWRHFLEGAKHKFEIWTDHRNLEYFAKAQQLNRRQARWALYLSRFNFELKFRPGKTMGKADALSR
RPDFEQGTKDDNKNQTLLKPEYFAIRAMEEGHMLINAEEGEILDEIRKSEAKEDDVVKAVEEMKRAKVKSLRGDE
WRLEEGLVLKEGKVYVPRDETLRTKIIRLHHDTPIAGHGGQWKTVEMVTRNYWWPGVTKQVQKYVEGCDQCQRNK
NRPAPPAGKLMPNPIPTKPWADVSVDFIVKLPESQGMDSILVVCDRFSTSGKGKVT*
Coding >Agabi119p4|780100
ATGTTCATGGATAAGGCGTTTGCAGAGGAAGAAGGGTTCAAGCTGGAACCTTTAGAGAGACCAATTCCGGTCAAA
AACGTTGATGGAACAATCAACGCATCTGGAGCAGTAACACACCGAGTTGCTGCAAACGTGTATTACAAAGGGCAT
AAAGAAAGAGTACACTTCGAGATATGTGGCCTTGGGAAAAATAAAGTCATATTAGGAATGCCTTGGTTACAAATG
CACAATCCGGAAATTGACTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGAC
AAAGGAAAAGCAAAAGAAAAGCAAGAAGAAATACGAAAGGTAGAAAAACCGAGGAAATCAACTAGGCAGTTGATG
AAAGAAGCACGAGAGGAAGAGAAAAGGGAAAAGCCTGACATGTCGCACAAACAATATGCAGGCTGGAAATTAATT
TCCTTCCCAAAGAAATCGAGTTGGGGAACGGTGTTGCAGTACAGATGTGAAGAGTGTGGAACCCAGACTTCAGAA
CATTTGCTGAGCAAGCACAAATGCCCAGCAATAGAGGAAATTGCCTTGGACGAGTTTGGGATGCCATACGAAGGA
AGTGATGATGAAGAGGAAGGGCCAACCATGGCAAAAATAGAAGCATATGAAAAGGAACAAGAAGAGATCAGAGAT
GAAGAAGACAGATTTGAACGAGTGAACAAAGCTATAGGAAGGTTCACTCAACCAAAGAACATCATCGAAGGAATT
GCATTGGGAGTCGAAGCAGCGTTCGCTAGGGAATTGGCACGAAACAGGCGTGCTAATGGTGGAGCTGAGGGATTG
GCGCAACAATCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGAT
AAGGCAGAACGTCTAGAAGAAGACAGCATCAAGACAGCCACCGCGGGCAAAGCGGAGGCTGGACAGGTACGTCCT
AAACGAATAAGCGCCCAAAAGAAAAATAGGAGTAGAGAAGAGGAAGAACAACTGGAAACATGGGTAAGAGGGATG
ACAGAAGAGATGCCGGAAGAAGAAGAAATTCGAAGCATAGACTCAGTGGAACAAATGGTGCCAAAACGGTTCCAC
AAATTCCTTAAAGTGTTCAAACAGAAGGAGTCAGAAAGGATGCCTACTAGAAAACCATGGGATCATGCTATCGAA
TTGAAGGAAGGTTTCAAACCCAAGAAAGGAAAAATATATCCCTTGTCACCAAACGAAAGGGAAGAGGTCCAAGCA
TTCGTCAAGGACCAACTTCGAAAGGGATATATCAGGCCATCGAAATCCCCTCAGACTTCGCCAGTATTTTTTGTG
CCAAAGAAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGACTGGACAATTAAGAACAATTAT
CCTCTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTTTCTAAGATAGATTTACGTTGG
GGTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAA
CCAACAGTTATGTTTTTTGGACTTACAAATTCGCCTGCTACTTTTCAGACTATGATGAACGAACTTTTTAGGGAC
TTAGTAAATACCGGGAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACGGACGATGAAGAGGAGCACGAT
AAGGTGGTGGAAGAAGTATTGCAGAGGTTGATGGACAACGACCTATTCGCAAAGCCAGAAAAATGCGAATGGAAG
CGAAGCGAGATGGGATTCCTAGGGTGTATAATAGGGAGGAATGGAATCAAGATGGAGGAAAGGAAGGTGAAAGAC
GTAGTAGAATGGCCAACCCCAAAATGCGTTAAAGACGTACAAAAGTTCTTGGGACTAGCAAACTATTATCGACGG
TTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAGGACAAGAAATGGAGTTGGGGA
GATGAAGAAGAAGAAGCCTTTGGTGCGTTAAAAGCAAAATTCACATCACATCCAATCCTAGTAGCACCAGAATTG
GACAAAGAACTAAAGGTGGAATCGGACGCATCAGCCTATGCCACGGGCGGAGAATTATCGATGAAATGTGAAGAT
GGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACGGAGACTGAACGAAATTACGATATTCACGACAGA
GAAATGTTGGGAATAATGCGATGTTTAGAGGAATGGAGACACTTCCTGGAAGGGGCAAAGCATAAATTCGAAATT
TGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAACCGACGACAAGCCAGATGGGCTTTG
TATTTATCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGAAAGGCAGACGCATTGAGCAGG
AGACCTGATTTCGAACAAGGAACAAAGGACGATAACAAGAATCAAACCTTGTTGAAACCAGAATATTTCGCAATT
CGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAGGAAGGAGAAATATTAGACGAAATCCGAAAATCAGAA
GCAAAAGAAGACGATGTGGTAAAAGCGGTGGAAGAAATGAAGCGAGCAAAAGTGAAGTCATTAAGAGGAGACGAG
TGGAGACTGGAAGAAGGACTAGTGTTGAAAGAAGGAAAAGTCTATGTGCCAAGAGATGAGACATTGAGAACGAAA
ATCATTCGACTACATCACGATACTCCCATTGCCGGACATGGAGGACAATGGAAGACAGTTGAAATGGTAACACGC
AACTACTGGTGGCCAGGCGTCACTAAGCAAGTCCAGAAATACGTAGAAGGATGCGACCAATGTCAACGGAATAAA
AATCGACCGGCACCACCAGCAGGTAAACTAATGCCAAACCCTATCCCTACAAAACCATGGGCCGACGTATCTGTC
GACTTCATAGTAAAGCTGCCAGAATCTCAGGGAATGGATTCAATCTTGGTGGTGTGTGATCGATTCAGTACATCA
GGAAAAGGTAAAGTGACTTAA
Transcript >Agabi119p4|780100
ATGTTCATGGATAAGGCGTTTGCAGAGGAAGAAGGGTTCAAGCTGGAACCTTTAGAGAGACCAATTCCGGTCAAA
AACGTTGATGGAACAATCAACGCATCTGGAGCAGTAACACACCGAGTTGCTGCAAACGTGTATTACAAAGGGCAT
AAAGAAAGAGTACACTTCGAGATATGTGGCCTTGGGAAAAATAAAGTCATATTAGGAATGCCTTGGTTACAAATG
CACAATCCGGAAATTGACTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGAC
AAAGGAAAAGCAAAAGAAAAGCAAGAAGAAATACGAAAGGTAGAAAAACCGAGGAAATCAACTAGGCAGTTGATG
AAAGAAGCACGAGAGGAAGAGAAAAGGGAAAAGCCTGACATGTCGCACAAACAATATGCAGGCTGGAAATTAATT
TCCTTCCCAAAGAAATCGAGTTGGGGAACGGTGTTGCAGTACAGATGTGAAGAGTGTGGAACCCAGACTTCAGAA
CATTTGCTGAGCAAGCACAAATGCCCAGCAATAGAGGAAATTGCCTTGGACGAGTTTGGGATGCCATACGAAGGA
AGTGATGATGAAGAGGAAGGGCCAACCATGGCAAAAATAGAAGCATATGAAAAGGAACAAGAAGAGATCAGAGAT
GAAGAAGACAGATTTGAACGAGTGAACAAAGCTATAGGAAGGTTCACTCAACCAAAGAACATCATCGAAGGAATT
GCATTGGGAGTCGAAGCAGCGTTCGCTAGGGAATTGGCACGAAACAGGCGTGCTAATGGTGGAGCTGAGGGATTG
GCGCAACAATCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGAT
AAGGCAGAACGTCTAGAAGAAGACAGCATCAAGACAGCCACCGCGGGCAAAGCGGAGGCTGGACAGGTACGTCCT
AAACGAATAAGCGCCCAAAAGAAAAATAGGAGTAGAGAAGAGGAAGAACAACTGGAAACATGGGTAAGAGGGATG
ACAGAAGAGATGCCGGAAGAAGAAGAAATTCGAAGCATAGACTCAGTGGAACAAATGGTGCCAAAACGGTTCCAC
AAATTCCTTAAAGTGTTCAAACAGAAGGAGTCAGAAAGGATGCCTACTAGAAAACCATGGGATCATGCTATCGAA
TTGAAGGAAGGTTTCAAACCCAAGAAAGGAAAAATATATCCCTTGTCACCAAACGAAAGGGAAGAGGTCCAAGCA
TTCGTCAAGGACCAACTTCGAAAGGGATATATCAGGCCATCGAAATCCCCTCAGACTTCGCCAGTATTTTTTGTG
CCAAAGAAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGACTGGACAATTAAGAACAATTAT
CCTCTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTTTCTAAGATAGATTTACGTTGG
GGTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAA
CCAACAGTTATGTTTTTTGGACTTACAAATTCGCCTGCTACTTTTCAGACTATGATGAACGAACTTTTTAGGGAC
TTAGTAAATACCGGGAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACGGACGATGAAGAGGAGCACGAT
AAGGTGGTGGAAGAAGTATTGCAGAGGTTGATGGACAACGACCTATTCGCAAAGCCAGAAAAATGCGAATGGAAG
CGAAGCGAGATGGGATTCCTAGGGTGTATAATAGGGAGGAATGGAATCAAGATGGAGGAAAGGAAGGTGAAAGAC
GTAGTAGAATGGCCAACCCCAAAATGCGTTAAAGACGTACAAAAGTTCTTGGGACTAGCAAACTATTATCGACGG
TTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAGGACAAGAAATGGAGTTGGGGA
GATGAAGAAGAAGAAGCCTTTGGTGCGTTAAAAGCAAAATTCACATCACATCCAATCCTAGTAGCACCAGAATTG
GACAAAGAACTAAAGGTGGAATCGGACGCATCAGCCTATGCCACGGGCGGAGAATTATCGATGAAATGTGAAGAT
GGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACGGAGACTGAACGAAATTACGATATTCACGACAGA
GAAATGTTGGGAATAATGCGATGTTTAGAGGAATGGAGACACTTCCTGGAAGGGGCAAAGCATAAATTCGAAATT
TGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAACCGACGACAAGCCAGATGGGCTTTG
TATTTATCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGAAAGGCAGACGCATTGAGCAGG
AGACCTGATTTCGAACAAGGAACAAAGGACGATAACAAGAATCAAACCTTGTTGAAACCAGAATATTTCGCAATT
CGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAGGAAGGAGAAATATTAGACGAAATCCGAAAATCAGAA
GCAAAAGAAGACGATGTGGTAAAAGCGGTGGAAGAAATGAAGCGAGCAAAAGTGAAGTCATTAAGAGGAGACGAG
TGGAGACTGGAAGAAGGACTAGTGTTGAAAGAAGGAAAAGTCTATGTGCCAAGAGATGAGACATTGAGAACGAAA
ATCATTCGACTACATCACGATACTCCCATTGCCGGACATGGAGGACAATGGAAGACAGTTGAAATGGTAACACGC
AACTACTGGTGGCCAGGCGTCACTAAGCAAGTCCAGAAATACGTAGAAGGATGCGACCAATGTCAACGGAATAAA
AATCGACCGGCACCACCAGCAGGTAAACTAATGCCAAACCCTATCCCTACAAAACCATGGGCCGACGTATCTGTC
GACTTCATAGTAAAGCTGCCAGAATCTCAGGGAATGGATTCAATCTTGGTGGTGTGTGATCGATTCAGTACATCA
GGAAAAGGTAAAGTGACTTAA
Gene >Agabi119p4|780100
ATGTTCATGGATAAGGCGTTTGCAGAGGAAGAAGGGTTCAAGCTGGAACCTTTAGAGAGACCAATTCCGGTCAAA
AACGTTGATGGAACAATCAACGCATCTGGAGCAGTAACACACCGAGTTGCTGCAAACGTGTATTACAAAGGGCAT
AAAGAAAGAGTACACTTCGAGATATGTGGCCTTGGGAAAAATAAAGTCATATTAGGAATGCCTTGGTTACAAATG
CACAATCCGGAAATTGACTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGAC
AAAGGAAAAGCAAAAGAAAAGCAAGAAGAAATACGAAAGGTAGAAAAACCGAGGAAATCAACTAGGCAGTTGATG
AAAGAAGCACGAGAGGAAGAGAAAAGGGAAAAGCCTGACATGTCGCACAAACAATATGCAGGCTGGAAATTAATT
TCCTTCCCAAAGAAATCGAGTTGGGGAACGGTGTTGCAGTACAGATGTGAAGAGTGTGGAACCCAGACTTCAGAA
CATTTGCTGAGCAAGCACAAATGCCCAGCAATAGAGGAAATTGCCTTGGACGAGTTTGGGATGCCATACGAAGGA
AGTGATGATGAAGAGGAAGGGCCAACCATGGCAAAAATAGAAGCATATGAAAAGGAACAAGAAGAGATCAGAGAT
GAAGAAGACAGATTTGAACGAGTGAACAAAGCTATAGGAAGGTTCACTCAACCAAAGAACATCATCGAAGGAATT
GCATTGGGAGTCGAAGCAGCGTTCGCTAGGGAATTGGCACGAAACAGGCGTGCTAATGGTGGAGCTGAGGGATTG
GCGCAACAATCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGAT
AAGGCAGAACGTCTAGAAGAAGACAGCATCAAGACAGCCACCGCGGGCAAAGCGGAGGCTGGACAGGTACGTCCT
AAACGAATAAGCGCCCAAAAGAAAAATAGGAGTAGAGAAGAGGAAGAACAACTGGAAACATGGGTAAGAGGGATG
ACAGAAGAGATGCCGGAAGAAGAAGAAATTCGAAGCATAGACTCAGTGGAACAAATGGTGCCAAAACGGTTCCAC
AAATTCCTTAAAGTGTTCAAACAGAAGGAGTCAGAAAGGATGCCTACTAGAAAACCATGGGATCATGCTATCGAA
TTGAAGGAAGGTTTCAAACCCAAGAAAGGAAAAATATATCCCTTGTCACCAAACGAAAGGGAAGAGGTCCAAGCA
TTCGTCAAGGACCAACTTCGAAAGGGATATATCAGGCCATCGAAATCCCCTCAGACTTCGCCAGTATTTTTTGTG
CCAAAGAAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGACTGGACAATTAAGAACAATTAT
CCTCTACCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACGATTATTTTCTAAGATAGATTTACGTTGG
GGTTATAATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAA
CCAACAGTTATGTTTTTTGGACTTACAAATTCGCCTGCTACTTTTCAGACTATGATGAACGAACTTTTTAGGGAC
TTAGTAAATACCGGGAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACGGACGATGAAGAGGAGCACGAT
AAGGTGGTGGAAGAAGTATTGCAGAGGTTGATGGACAACGACCTATTCGCAAAGCCAGAAAAATGCGAATGGAAG
CGAAGCGAGATGGGATTCCTAGGGTGTATAATAGGGAGGAATGGAATCAAGATGGAGGAAAGGAAGGTGAAAGAC
GTAGTAGAATGGCCAACCCCAAAATGCGTTAAAGACGTACAAAAGTTCTTGGGACTAGCAAACTATTATCGACGG
TTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAGGACAAGAAATGGAGTTGGGGA
GATGAAGAAGAAGAAGCCTTTGGTGCGTTAAAAGCAAAATTCACATCACATCCAATCCTAGTAGCACCAGAATTG
GACAAAGAACTAAAGGTGGAATCGGACGCATCAGCCTATGCCACGGGCGGAGAATTATCGATGAAATGTGAAGAT
GGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACGGAGACTGAACGAAATTACGATATTCACGACAGA
GAAATGTTGGGAATAATGCGATGTTTAGAGGAATGGAGACACTTCCTGGAAGGGGCAAAGCATAAATTCGAAATT
TGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAACCGACGACAAGCCAGATGGGCTTTG
TATTTATCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGAAAGGCAGACGCATTGAGCAGG
AGACCTGATTTCGAACAAGGAACAAAGGACGATAACAAGAATCAAACCTTGTTGAAACCAGAATATTTCGCAATT
CGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAGGAAGGAGAAATATTAGACGAAATCCGAAAATCAGAA
GCAAAAGAAGACGATGTGGTAAAAGCGGTGGAAGAAATGAAGCGAGCAAAAGTGAAGTCATTAAGAGGAGACGAG
TGGAGACTGGAAGAAGGACTAGTGTTGAAAGAAGGAAAAGTCTATGTGCCAAGAGATGAGACATTGAGAACGAAA
ATCATTCGACTACATCACGATACTCCCATTGCCGGACATGGAGGACAATGGAAGACAGTTGAAATGGTAACACGC
AACTACTGGTGGCCAGGCGTCACTAAGCAAGTCCAGAAATACGTAGAAGGATGCGACCAATGTCAACGGAATAAA
AATCGACCGGCACCACCAGCAGGTAAACTAATGCCAAACCCTATCCCTACAAAACCATGGGCCGACGTATCTGTC
GACTTCATAGTAAAGCTGCCAGAATCTCAGGGAATGGATTCAATCTTGGTGGTGTGTGATCGATTCAGTACATCA
GGAAAAGGTAAAGTGACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail