Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|776300
Gene name
Locationscaffold_12:1245215..1245903
Strand-
Gene length (bp)688
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase 1.3E-59 4 154
PF07883 Cupin_2 Cupin domain 1.7E-06 38 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1C874|3HAO2_ASPCL 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna1-2 PE=3 SV=2 1 174 2.0E-81
sp|Q2UB88|3HAO2_ASPOR 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bna1-2 PE=3 SV=1 3 174 4.0E-80
sp|B0XVP0|3HAO2_ASPFC 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bna1-2 PE=3 SV=2 1 174 2.0E-78
sp|Q4WZC3|3HAO2_ASPFU 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna1-2 PE=3 SV=2 1 174 2.0E-78
sp|Q4P2Q7|3HAO_USTMA 3-hydroxyanthranilate 3,4-dioxygenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BNA1 PE=3 SV=1 1 168 3.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1C874|3HAO2_ASPCL 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna1-2 PE=3 SV=2 1 174 2.0E-81
sp|Q2UB88|3HAO2_ASPOR 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bna1-2 PE=3 SV=1 3 174 4.0E-80
sp|B0XVP0|3HAO2_ASPFC 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bna1-2 PE=3 SV=2 1 174 2.0E-78
sp|Q4WZC3|3HAO2_ASPFU 3-hydroxyanthranilate 3,4-dioxygenase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna1-2 PE=3 SV=2 1 174 2.0E-78
sp|Q4P2Q7|3HAO_USTMA 3-hydroxyanthranilate 3,4-dioxygenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BNA1 PE=3 SV=1 1 168 3.0E-76
sp|A4REV8|3HAO_MAGO7 3-hydroxyanthranilate 3,4-dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=BNA1 PE=3 SV=1 3 172 9.0E-76
sp|Q7SDX3|3HAO_NEUCR 3-hydroxyanthranilate 3,4-dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bna1 PE=3 SV=1 3 172 3.0E-74
sp|Q2HD63|3HAO_CHAGB 3-hydroxyanthranilate 3,4-dioxygenase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BNA1 PE=3 SV=1 3 172 3.0E-73
sp|P0CL86|3HAO_CRYNJ 3-hydroxyanthranilate 3,4-dioxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BNA1 PE=3 SV=1 3 174 7.0E-73
sp|P0CL87|3HAO_CRYNB 3-hydroxyanthranilate 3,4-dioxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BNA1 PE=3 SV=1 3 174 7.0E-73
sp|B2AAJ5|3HAO_PODAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=BNA1 PE=3 SV=1 3 171 1.0E-71
sp|Q6CFX1|3HAO_YARLI 3-hydroxyanthranilate 3,4-dioxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BNA1 PE=3 SV=1 3 174 1.0E-70
sp|A3LP72|3HAO_PICST 3-hydroxyanthranilate 3,4-dioxygenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA1 PE=3 SV=1 3 174 1.0E-70
sp|Q59K86|3HAO_CANAL 3-hydroxyanthranilate 3,4-dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA1 PE=3 SV=1 1 174 3.0E-68
sp|A5E0Z9|3HAO_LODEL 3-hydroxyanthranilate 3,4-dioxygenase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=BNA1 PE=3 SV=1 1 174 7.0E-67
sp|Q1E5I0|3HAO_COCIM 3-hydroxyanthranilate 3,4-dioxygenase OS=Coccidioides immitis (strain RS) GN=BNA1 PE=3 SV=1 3 170 2.0E-65
sp|A2R8S7|3HAO_ASPNC 3-hydroxyanthranilate 3,4-dioxygenase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bna1 PE=3 SV=1 3 174 3.0E-65
sp|Q2UHT9|3HAO1_ASPOR 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bna1-1 PE=3 SV=1 3 174 3.0E-65
sp|A1C408|3HAO1_ASPCL 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna1-1 PE=3 SV=1 3 174 6.0E-64
sp|Q4WCF1|3HAO1_ASPFU 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna1-1 PE=3 SV=1 3 172 4.0E-62
sp|B0Y9Z9|3HAO1_ASPFC 3-hydroxyanthranilate 3,4-dioxygenase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bna1-1 PE=3 SV=1 3 172 4.0E-62
sp|A1DB76|3HAO_NEOFI 3-hydroxyanthranilate 3,4-dioxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bna1 PE=3 SV=1 3 172 1.0E-61
sp|Q75CP6|3HAO_ASHGO 3-hydroxyanthranilate 3,4-dioxygenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA1 PE=3 SV=1 6 173 1.0E-61
sp|Q0D1U6|3HAO_ASPTN 3-hydroxyanthranilate 3,4-dioxygenase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bna1 PE=3 SV=2 3 174 2.0E-61
sp|A5DLW3|3HAO_PICGU 3-hydroxyanthranilate 3,4-dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA1 PE=3 SV=2 3 169 8.0E-61
sp|P47096|3HAO_YEAST 3-hydroxyanthranilate 3,4-dioxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA1 PE=1 SV=1 6 170 9.0E-58
sp|Q54S02|3HAO_DICDI 3-hydroxyanthranilate 3,4-dioxygenase OS=Dictyostelium discoideum GN=haao PE=3 SV=1 3 172 1.0E-54
sp|Q2P320|3HAO_XANOM 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nbaC PE=3 SV=2 3 170 1.0E-46
sp|Q5H043|3HAO_XANOR 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nbaC PE=3 SV=2 3 170 1.0E-46
sp|Q3BV37|3HAO_XANC5 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nbaC PE=3 SV=1 3 170 1.0E-45
sp|Q8PAD0|3HAO_XANCP 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nbaC PE=3 SV=1 3 170 2.0E-45
sp|Q4UT95|3HAO_XANC8 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nbaC PE=3 SV=1 3 170 2.0E-45
sp|B0RUZ7|3HAO_XANCB 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=nbaC PE=3 SV=1 3 170 2.0E-45
sp|Q8PM31|3HAO_XANAC 3-hydroxyanthranilate 3,4-dioxygenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nbaC PE=3 SV=1 3 168 4.0E-45
sp|P46953|3HAO_RAT 3-hydroxyanthranilate 3,4-dioxygenase OS=Rattus norvegicus GN=Haao PE=1 SV=2 11 165 5.0E-41
sp|Q28SE8|3HAO_JANSC 3-hydroxyanthranilate 3,4-dioxygenase OS=Jannaschia sp. (strain CCS1) GN=nbaC PE=3 SV=1 7 170 1.0E-40
sp|Q78JT3|3HAO_MOUSE 3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus GN=Haao PE=1 SV=1 12 165 6.0E-40
sp|Q6DIZ0|3HAO_XENTR 3-hydroxyanthranilate 3,4-dioxygenase OS=Xenopus tropicalis GN=haao PE=2 SV=1 3 165 6.0E-40
sp|A6X798|3HAO_OCHA4 3-hydroxyanthranilate 3,4-dioxygenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nbaC PE=3 SV=1 7 170 1.0E-39
sp|Q6P7I0|3HAO_XENLA 3-hydroxyanthranilate 3,4-dioxygenase OS=Xenopus laevis GN=haao PE=2 SV=1 3 165 3.0E-39
sp|P46952|3HAO_HUMAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Homo sapiens GN=HAAO PE=1 SV=2 7 165 3.0E-39
sp|A7RIT9|3HAO_NEMVE 3-hydroxyanthranilate 3,4-dioxygenase OS=Nematostella vectensis GN=v1g178517 PE=3 SV=1 11 165 5.0E-39
sp|Q0VCA8|3HAO_BOVIN 3-hydroxyanthranilate 3,4-dioxygenase OS=Bos taurus GN=HAAO PE=1 SV=1 6 165 8.0E-39
sp|Q5LSJ4|3HAO_RUEPO 3-hydroxyanthranilate 3,4-dioxygenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nbaC PE=3 SV=1 7 170 7.0E-38
sp|C1ERL1|3HAO_BACC3 3-hydroxyanthranilate 3,4-dioxygenase OS=Bacillus cereus (strain 03BB102) GN=nbaC PE=3 SV=1 7 170 9.0E-38
sp|A0RD64|3HAO_BACAH 3-hydroxyanthranilate 3,4-dioxygenase OS=Bacillus thuringiensis (strain Al Hakam) GN=nbaC PE=3 SV=1 7 170 1.0E-37
sp|Q739J0|3HAO_BACC1 3-hydroxyanthranilate 3,4-dioxygenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nbaC PE=3 SV=1 7 170 2.0E-37
sp|Q5U3F8|3HAO_DANRE 3-hydroxyanthranilate 3,4-dioxygenase OS=Danio rerio GN=haao PE=2 SV=1 7 160 1.0E-36
sp|B1KJM7|3HAO_SHEWM 3-hydroxyanthranilate 3,4-dioxygenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nbaC PE=3 SV=1 7 170 5.0E-36
sp|B2T2S5|3HAO_BURPP 3-hydroxyanthranilate 3,4-dioxygenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nbaC PE=3 SV=1 6 170 3.0E-35
sp|Q1LCS4|3HAO_CUPMC 3-hydroxyanthranilate 3,4-dioxygenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nbaC PE=1 SV=1 6 170 1.0E-34
sp|Q83V26|3HAO_PSEFL 3-hydroxyanthranilate 3,4-dioxygenase OS=Pseudomonas fluorescens GN=nbaC PE=1 SV=1 3 170 2.0E-34
sp|Q39LI1|3HAO_BURL3 3-hydroxyanthranilate 3,4-dioxygenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nbaC PE=3 SV=2 6 168 4.0E-34
sp|Q60W34|3HAO_CAEBR 3-hydroxyanthranilate 3,4-dioxygenase OS=Caenorhabditis briggsae GN=haao-1 PE=3 SV=2 1 165 1.0E-33
sp|B4EFS7|3HAO_BURCJ 3-hydroxyanthranilate 3,4-dioxygenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nbaC PE=3 SV=1 1 170 1.0E-33
sp|Q46PT7|3HAO_CUPPJ 3-hydroxyanthranilate 3,4-dioxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nbaC PE=3 SV=1 6 170 4.0E-33
sp|Q19341|3HAO_CAEEL 3-hydroxyanthranilate 3,4-dioxygenase OS=Caenorhabditis elegans GN=haao-1 PE=3 SV=2 1 165 5.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0000334 3-hydroxyanthranilate 3,4-dioxygenase activity Yes
GO:0051213 dioxygenase activity No
GO:0016491 oxidoreductase activity No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|776300
MPLAPPLNFPKWLSENGHLLQPPVNNYCIYRGGDYVIMAVGGPNERNDYHINETEEWFYQYKGGMLLRVVDDTEF
KDIRIEEGEMFLLPANTPHNPVRFANTIGIVVERVRPEGSQDRLRWYCRSDAHKEPTVIYEEAFHVTDLGSQLKP
VIQRWQNNEELRKCKTCATVAEPK*
Coding >Agabi119p4|776300
ATGCCTCTTGCACCGCCTCTCAACTTTCCGAAATGGCTGAGCGAAAACGGACATCTCTTGCAGCCCCCAGTGAAC
AATTATTGCATCTACAGAGGAGGCGACTACGTCATCATGGCAGTTGGCGGGCCTAACGAAAGGAATGACTACCAC
ATCAACGAAACCGAGGAATGGTTCTACCAATACAAAGGTGGAATGTTACTCCGAGTCGTGGATGACACAGAGTTC
AAAGACATCAGAATCGAAGAAGGCGAAATGTTTCTGTTGCCAGCAAATACACCGCACAATCCTGTTCGTTTTGCT
AATACAATCGGAATAGTAGTTGAGCGTGTGCGACCCGAGGGATCTCAGGACCGGTTACGATGGTATTGTCGCTCT
GATGCTCATAAGGAGCCTACGGTCATCTATGAAGAAGCCTTCCACGTTACCGATCTGGGATCTCAATTGAAACCT
GTCATACAGCGCTGGCAAAACAACGAGGAACTTAGAAAATGCAAGACTTGCGCAACTGTTGCGGAACCCAAATAA
Transcript >Agabi119p4|776300
ATGCCTCTTGCACCGCCTCTCAACTTTCCGAAATGGCTGAGCGAAAACGGACATCTCTTGCAGCCCCCAGTGAAC
AATTATTGCATCTACAGAGGAGGCGACTACGTCATCATGGCAGTTGGCGGGCCTAACGAAAGGAATGACTACCAC
ATCAACGAAACCGAGGAATGGTTCTACCAATACAAAGGTGGAATGTTACTCCGAGTCGTGGATGACACAGAGTTC
AAAGACATCAGAATCGAAGAAGGCGAAATGTTTCTGTTGCCAGCAAATACACCGCACAATCCTGTTCGTTTTGCT
AATACAATCGGAATAGTAGTTGAGCGTGTGCGACCCGAGGGATCTCAGGACCGGTTACGATGGTATTGTCGCTCT
GATGCTCATAAGGAGCCTACGGTCATCTATGAAGAAGCCTTCCACGTTACCGATCTGGGATCTCAATTGAAACCT
GTCATACAGCGCTGGCAAAACAACGAGGAACTTAGAAAATGCAAGACTTGCGCAACTGTTGCGGAACCCAAATAA
Gene >Agabi119p4|776300
ATGCCTCTTGCACCGCCTCTCAACTTTCCGAAATGGCTGAGCGAAAACGGACATCTCTTGCAGCCCCCAGTGAAC
AATTATTGCATCTACAGAGGAGGCGACTACGTCATCATGGCAGTTGGCGGGCCTAACGAAAGGAATGACTACCAC
ATCAACGAAACCGAGGTCAGCCCTTGTTTATGAAGGCGAGATATTCTTGGTTTATGATTCCCCAGGAATGGTTCT
ACCAATACAAAGGTGGAATGTTACTCCGAGTCGTGGATGACACAGAGTTCAAAGACATCAGAATCGAAGAAGGCG
AAATGTTTCTGTTGCCAGGTATTGCCTCATCTTATTGTTTTCTTTTCCGTTCTCAAGAGTCCTTTTCAATGTAGC
AAATACACCGCACAATCCTGTTCGTTTTGCTAATACAATCGGAATAGTAGTTGAGCGTGTGCGACCCGAGGGATC
TCAGGGTAAGACTTTTAATTATCGATCTAACCGGTAATTCAAAATTGATATCTGGTTCCTAGACCGGTTACGATG
GTATTGTCGCTCTGATGCTCATAAGGAGCCTACGGTCATCTATGAAGAAGCCTTCCACGTTACCGATCTGGGATC
TCAATTGAAACCTGTCATACAGCGCTGGCAAAACAACGAGGAACTTAGAAAATGCAAGACTTGCGCAACTGTTGC
GGAACCCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail