Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|774850
Gene name
Locationscaffold_12:1099252..1101482
Strand-
Gene length (bp)2230
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 1.7E-18 166 298
PF00190 Cupin_1 Cupin 9.3E-18 351 481
PF07883 Cupin_2 Cupin domain 1.9E-09 189 257
PF07883 Cupin_2 Cupin domain 1.1E-13 376 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 109 494 1.0E-126
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 101 494 1.0E-102
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 121 495 3.0E-82
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 121 494 9.0E-75
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 326 497 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 109 494 1.0E-126
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 101 494 1.0E-102
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 121 495 3.0E-82
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 121 494 9.0E-75
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 326 497 1.0E-15
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 326 496 2.0E-15
sp|Q59013|Y1618_METJA Uncharacterized protein MJ1618 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1618 PE=4 SV=1 373 447 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|774850
MFSLLLRRLGICLAIGFTVKAIPTPPGHEIVQYNPGRFTLRGMDYPRIYKPDSDSDDTTPAFISRDRRPDRYYDK
PEPVSATSDDDLFNFHPLRPPFQARDQKRANGIQTTTPQTVRGKYGAPMLGPENVALVEQNLDLLRPPKTDSGSV
MNFKWPFSFSHNRLTEGGWARHQNEKQMPIAKDLAAVNMRLKAGAIREMHWHVTNEWAYVLKGSLRVSVLAPGGE
NEGVMYVADVNEGDLWYFPAGDPHSLQAKDTNPEGAEFLLIFDSGAFDENETFLLTDWLVHVPKEVLAKNFQTYP
DTTPFDHIPEEELYIFPSTPPSEDINKDLVVPNPTDPKYFFAYPFSKVEPIKYPGGTVKVADSRSFEASKNIAVA
EVEVEVGGIRELHWHPTQPEWTFILSGKARITLFASQHNAATYDFFAGDVAYIPPTFGHYVENIGDEPLKFLEVL
KTDVFQDISLRQWLALTPHNVVKAHLGFSEQFIDALPREKQVIVSGEQADWSSDEETM*
Coding >Agabi119p4|774850
ATGTTTTCCCTCCTCCTACGTCGTCTCGGAATCTGCTTGGCCATTGGTTTCACTGTCAAGGCGATACCCACTCCC
CCCGGACATGAAATCGTACAGTATAACCCAGGTCGCTTTACCCTCAGGGGAATGGACTATCCTCGCATCTATAAA
CCAGATTCTGACTCCGACGATACCACTCCCGCTTTCATTTCACGCGATAGGAGACCTGACCGTTATTACGACAAA
CCCGAACCCGTGTCAGCTACCAGCGACGACGATCTATTCAATTTTCACCCTTTGAGACCACCTTTTCAGGCTCGT
GACCAGAAACGCGCCAATGGAATACAGACGACGACACCTCAAACCGTTAGAGGAAAGTATGGTGCACCTATGTTG
GGGCCGGAGAATGTAGCTTTGGTGGAACAGAATTTGGATTTGTTGAGGCCGCCGAAGACGGATTCGGGGAGTGTG
ATGAATTTCAAATGGCCGTTTTCGTTCAGTCATAATAGATTGACGGAGGGTGGATGGGCAAGGCATCAGAATGAG
AAACAGATGCCTATTGCCAAAGATTTGGCGGCGGTCAATATGCGTTTGAAAGCTGGAGCTATAAGAGAAATGCAC
TGGCATGTTACGAACGAGTGGGCATACGTCTTGAAAGGTTCTTTGCGAGTCAGTGTGTTGGCTCCAGGTGGAGAA
AACGAGGGAGTGATGTATGTGGCTGACGTCAACGAAGGAGATCTTTGGTACTTCCCAGCAGGCGATCCTCATTCC
CTTCAAGCCAAAGACACAAACCCCGAAGGAGCAGAATTTTTACTCATATTTGATTCAGGTGCTTTCGACGAGAAT
GAAACATTTCTTTTGACAGATTGGCTTGTACACGTTCCGAAAGAGGTTTTGGCGAAGAATTTTCAGACGTATCCG
GATACGACGCCGTTTGATCATATTCCAGAAGAGGAGTTGTATATCTTTCCTTCGACCCCACCATCAGAGGATATC
AATAAGGACTTGGTTGTTCCAAATCCGACAGATCCGAAATACTTTTTTGCTTACCCTTTTTCGAAAGTTGAGCCG
ATAAAATATCCTGGTGGAACGGTCAAGGTGGCGGATTCTAGAAGTTTTGAAGCTTCGAAAAACATTGCCGTTGCT
GAAGTTGAGGTTGAAGTTGGTGGGATACGGGAGCTACATTGGCACCCGACACAACCTGAGTGGACGTTTATATTA
TCCGGGAAAGCAAGAATAACACTATTCGCTTCGCAACACAATGCTGCTACGTACGATTTTTTCGCTGGTGATGTG
GCATACATCCCTCCTACCTTCGGTCACTACGTTGAGAATATTGGAGACGAGCCTTTGAAGTTTTTAGAGGTTCTC
AAGACAGATGTCTTCCAGGATATATCACTCAGACAGTGGTTGGCTTTGACACCTCATAATGTCGTCAAAGCACAT
CTTGGGTTTAGCGAACAATTCATTGATGCACTTCCGAGGGAGAAGCAGGTAATTGTATCAGGGGAACAGGCTGAC
TGGTCTTCGGACGAGGAAACAATGTAA
Transcript >Agabi119p4|774850
ATGTTTTCCCTCCTCCTACGTCGTCTCGGAATCTGCTTGGCCATTGGTTTCACTGTCAAGGCGATACCCACTCCC
CCCGGACATGAAATCGTACAGTATAACCCAGGTCGCTTTACCCTCAGGGGAATGGACTATCCTCGCATCTATAAA
CCAGATTCTGACTCCGACGATACCACTCCCGCTTTCATTTCACGCGATAGGAGACCTGACCGTTATTACGACAAA
CCCGAACCCGTGTCAGCTACCAGCGACGACGATCTATTCAATTTTCACCCTTTGAGACCACCTTTTCAGGCTCGT
GACCAGAAACGCGCCAATGGAATACAGACGACGACACCTCAAACCGTTAGAGGAAAGTATGGTGCACCTATGTTG
GGGCCGGAGAATGTAGCTTTGGTGGAACAGAATTTGGATTTGTTGAGGCCGCCGAAGACGGATTCGGGGAGTGTG
ATGAATTTCAAATGGCCGTTTTCGTTCAGTCATAATAGATTGACGGAGGGTGGATGGGCAAGGCATCAGAATGAG
AAACAGATGCCTATTGCCAAAGATTTGGCGGCGGTCAATATGCGTTTGAAAGCTGGAGCTATAAGAGAAATGCAC
TGGCATGTTACGAACGAGTGGGCATACGTCTTGAAAGGTTCTTTGCGAGTCAGTGTGTTGGCTCCAGGTGGAGAA
AACGAGGGAGTGATGTATGTGGCTGACGTCAACGAAGGAGATCTTTGGTACTTCCCAGCAGGCGATCCTCATTCC
CTTCAAGCCAAAGACACAAACCCCGAAGGAGCAGAATTTTTACTCATATTTGATTCAGGTGCTTTCGACGAGAAT
GAAACATTTCTTTTGACAGATTGGCTTGTACACGTTCCGAAAGAGGTTTTGGCGAAGAATTTTCAGACGTATCCG
GATACGACGCCGTTTGATCATATTCCAGAAGAGGAGTTGTATATCTTTCCTTCGACCCCACCATCAGAGGATATC
AATAAGGACTTGGTTGTTCCAAATCCGACAGATCCGAAATACTTTTTTGCTTACCCTTTTTCGAAAGTTGAGCCG
ATAAAATATCCTGGTGGAACGGTCAAGGTGGCGGATTCTAGAAGTTTTGAAGCTTCGAAAAACATTGCCGTTGCT
GAAGTTGAGGTTGAAGTTGGTGGGATACGGGAGCTACATTGGCACCCGACACAACCTGAGTGGACGTTTATATTA
TCCGGGAAAGCAAGAATAACACTATTCGCTTCGCAACACAATGCTGCTACGTACGATTTTTTCGCTGGTGATGTG
GCATACATCCCTCCTACCTTCGGTCACTACGTTGAGAATATTGGAGACGAGCCTTTGAAGTTTTTAGAGGTTCTC
AAGACAGATGTCTTCCAGGATATATCACTCAGACAGTGGTTGGCTTTGACACCTCATAATGTCGTCAAAGCACAT
CTTGGGTTTAGCGAACAATTCATTGATGCACTTCCGAGGGAGAAGCAGGTAATTGTATCAGGGGAACAGGCTGAC
TGGTCTTCGGACGAGGAAACAATGTAA
Gene >Agabi119p4|774850
ATGTTTTCCCTCCTCCTACGTCGTCTCGGAATCTGCTTGGCCATTGGTTTCACTGTCAAGGCGATACCCACTCCC
CCCGGACATGAAATCGTACAGTATAACCCAGGTCGCTTTACCCTCAGGGGAATGGACTATCCTCGCATCTATAAA
CCAGATTCTGACTCCGACGATACCACTCCCGCTTTCATTTCACGCGATAGGAGACCTGACCGTTATTACGACAAA
CCCGAACCCGTGTCAGCTACCAGCGACGACGATCTATTCAATTTTCACCCTTTGAGACCACCTTTTCAGGCTCGT
GACCAGAAACGCGCCAATGGAATACAGACGACGACACCTCAAACCGTTAGAGGAAAGTATGGTGCACCTATGTTG
GGGCCGGAGAATGTAGCTTTGGTGGAACAGAATTTGGATTTGTTGAGGCCGCCGAAGACGGATTCGGGGAGTGTG
ATGAATTTCAAATGGCCGTTTTCGTTCAGTCATAATAGATTGACGGAGGGTGGATGGGCAAGGCATCAGAATGGT
GTGGCCTCCGTTTTCTCCACTCTTCTTTCATATATTTACGAGCGACTACAGAGAAACAGATGCCTATTGCCAAAG
ATTTGGCGGGTGATTTTTTTTCCTCTTAATCGCGGACGCTGTTGGGTGATATGCTAACCTGTGATTGTTTGCCCT
TCAGCGGTCAATATGCGTTTGAAAGCTGGAGCTATAAGGTACGTATGTTCTTGTGGATTATCGAAGCGTCCTTAA
ACGTATATGGACAGAGAAATGCACTGGCATGTTACGAACGAGGTCCGTATATTTGCGTTCGATCGCCTCTAGCTA
TTTACTGACAGGGCTTTTAGTGGGCATACGTCTTGAAAGGTTCTTTGCGAGTCAGTGTGTTGGCTCCAGGTGGAG
AAAACGAGGGAGTGATGTATGTGGCTGACGTCGTACGTTATCTCTCTCTCTCTCTTCAACTCTCGCGCCTCAATG
ATGTTTCAGAACGAAGGAGATCTTTGGTACTTCCCAGCAGGCGATCCTCATTCCCTTCAAGCCAAAGACACAAAC
CCCGAAGGAGCAGAATTTTTACTCATATTTGATTCAGGTGCTTTCGACGAGAATGAAACATTTCTTTTGACAGAT
TGGCTTGTACACGTTCCGAAAGAGGTTTTGGCGAAGAATTTTCAGACGTATCCGGATACGACGCCGTTTGATCAT
ATTCCAGAAGAGGAGTTGTATATCTTTCCTTGTGAGTTTGCTATTCGGCGTCCACGCCAATCTAACATTCTGGAA
TCATTGATTCATATTTCTTATTCATAAGCGACCCCACCATCAGAGGATATCAATAAGGACTTGGTTGTTCCAAAT
CCGACAGATCCGAAATACTTTTTTGCTTACCCTTTTTCGAAAGTTGAGCCGATAAAATATCCTGGTGGAACGGTC
AAGGTGGCGGATTCTAGAAGTTTTGAAGCTTCGAAAAACATTGCCGTTGCTGAAGTTGAGGTTGAAGTTGGTGGG
ATACGGTATGTTTTGATCTATAAGTAGCCTGTTTTGCCTGACGGTCCATGTTACCCTTTTATGCAGGGAGCTACA
TGTGAGTTGTACTGATTTCGTGTACAGCATTTGGATAGGCGATAATAGTCATTTAATTTCAGTGGCACCCGACAC
AACCTGAGTGGACGTTTATATTGTAAAGCTTTTCTTATTGATCTCGCTGAGCTGTTGACTCATGACATATCCACT
AGATCCGGGAAAGCAAGAATAACACTATTCGCTTCGCAACACAATGCTGCTACGTACGATTTTTTCGTGAGTCTT
ATCCCATGTTAGGTTGAGAGCAGAACCGTTGTTGATCTTTCGAGTCGATAGGCTGGTGATGTGGCATACATCCCT
CCTACCTTCGGTTTGTATCTTCCTCAATGAAATCATATCTGTTACTCATTTTTTTCTTTGTCTCTGTGAAGGTCA
CTACGTTGAGAATATTGGAGACGAGCCTTTGAAGTTTTTAGAGGTTCTCAAGACAGGTCAGTCGGTTGACTTAGC
TAAATTTCCGTGTATGTCGTTAACTGCGATGGTAGATGTCTTCCAGGATATATCACTCAGACAGTGGTTGGCTTT
GACACCTCATAATGTCGTCAAAGCACATCTTGGGTTTAGCGAACAATTCATTGATGCACTTCCGAGGGAGAAGCA
GGTAATTGTATCAGGGGAACAGGCTGACTGGTCTTCGGACGAGGAAACAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail