Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|770800
Gene name
Locationscaffold_12:764295..765838
Strand+
Gene length (bp)1543
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.1E-12 36 162

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID5
Orthogroup218
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|082250
Agaricus bisporus var bisporus H97 AgabiH97|082250
Agaricus bisporus var burnettii H119p4 Agabi119p4|564700
Agaricus bisporus var burnettii H119p4 Agabi119p4|606100
Agaricus bisporus var burnettii H119p4 Agabi119p4|637100
Agaricus bisporus var burnettii H119p4 Agabi119p4|770150
Agaricus bisporus var burnettii H119p4 Agabi119p4|770800 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|770800
MVNGSDNSAWEMSGSSAPPLPTTDPVEIRARSLLSARASAIIESHLPNSMLSQAAAQTDARALWSWLEGQYGQKG
PTFAYERFVTAQNFKINDSTDPSSAIADLYALFAAVESTGALIHELIRTMMLLNALPNRFEHVASNILAEKRSVA
DLKWEETRARIIAAWCNPHTVANAACFRQQNQPKPKWDKQKPDQGQGKSQGSGSGSGSGQNQNKQQQPQQKKKAS
IEEVKDTTPDYSASSAIASMARLTSTSTRAKVDEMKSRSPKLGNHTISGEEFLFFPDGNMIDLSPPDTDIDSWTL
PRLRPATRNLLSDKSDVDLDPSDSGSIPRDPRKRPSSCHSPTPYERAKTKVLSLWDQRLNAVTVTAPPIEDGAGQ
VGGNAPAVKMPATKGKQVEKMDVDKADEISLGDEDGEFEAVLSPETKAWLNQPISEEDWAALRGFD*
Coding >Agabi119p4|770800
ATGGTCAACGGCTCCGATAATTCGGCTTGGGAAATGAGTGGTTCCTCTGCTCCTCCTCTGCCAACCACAGATCCG
GTTGAGATACGAGCTCGTTCTCTCCTCTCGGCCCGAGCATCTGCTATTATCGAGTCCCATCTCCCAAATTCGATG
CTCAGTCAAGCGGCCGCTCAAACGGACGCTAGAGCTCTTTGGAGTTGGTTAGAAGGCCAGTACGGCCAAAAAGGA
CCGACATTCGCTTACGAGCGTTTCGTCACGGCTCAAAATTTCAAAATAAACGACTCCACCGATCCATCGTCTGCG
ATTGCAGATCTCTATGCACTATTTGCCGCTGTTGAAAGCACCGGTGCGTTGATCCATGAATTGATCCGCACCATG
ATGCTCCTCAACGCTCTCCCCAACCGGTTCGAGCATGTCGCTTCGAACATTCTAGCTGAGAAAAGATCGGTTGCC
GATCTTAAATGGGAGGAAACCCGTGCCCGCATCATCGCTGCGTGGTGCAACCCCCATACAGTTGCCAATGCTGCG
TGTTTCCGCCAGCAGAACCAGCCAAAACCCAAATGGGACAAACAAAAACCCGATCAAGGTCAGGGTAAGTCCCAA
GGCTCTGGTTCCGGTTCTGGCTCCGGCCAGAATCAAAACAAGCAACAACAACCTCAGCAGAAGAAGAAAGCCTCT
ATCGAAGAAGTCAAGGATACCACTCCTGACTATTCCGCTTCTTCTGCCATCGCCTCGATGGCGCGGCTCACATCC
ACCTCTACTCGCGCGAAAGTTGATGAGATGAAGAGCAGATCGCCCAAGTTGGGCAACCATACTATTTCGGGTGAG
GAATTTCTTTTCTTCCCTGATGGTAATATGATTGATCTTTCCCCTCCGGATACTGACATTGACTCTTGGACTTTG
CCTCGGCTTCGTCCCGCAACGCGAAATCTCCTATCAGACAAATCTGATGTTGATCTTGATCCATCAGACTCCGGG
TCGATCCCTCGGGACCCTCGGAAACGTCCTTCCTCTTGCCATTCCCCCACACCCTACGAAAGGGCCAAAACGAAA
GTGTTATCCCTCTGGGATCAACGTCTTAACGCAGTGACTGTTACAGCCCCTCCAATCGAGGATGGGGCCGGTCAA
GTGGGTGGTAATGCTCCGGCTGTAAAAATGCCGGCTACGAAAGGAAAACAAGTTGAGAAGATGGATGTTGATAAG
GCTGATGAGATTTCTCTCGGCGATGAAGATGGAGAATTTGAGGCAGTACTGTCTCCAGAAACAAAGGCTTGGTTG
AACCAGCCTATCTCCGAGGAAGATTGGGCCGCTCTTCGTGGCTTCGATTAG
Transcript >Agabi119p4|770800
ATGGTCAACGGCTCCGATAATTCGGCTTGGGAAATGAGTGGTTCCTCTGCTCCTCCTCTGCCAACCACAGATCCG
GTTGAGATACGAGCTCGTTCTCTCCTCTCGGCCCGAGCATCTGCTATTATCGAGTCCCATCTCCCAAATTCGATG
CTCAGTCAAGCGGCCGCTCAAACGGACGCTAGAGCTCTTTGGAGTTGGTTAGAAGGCCAGTACGGCCAAAAAGGA
CCGACATTCGCTTACGAGCGTTTCGTCACGGCTCAAAATTTCAAAATAAACGACTCCACCGATCCATCGTCTGCG
ATTGCAGATCTCTATGCACTATTTGCCGCTGTTGAAAGCACCGGTGCGTTGATCCATGAATTGATCCGCACCATG
ATGCTCCTCAACGCTCTCCCCAACCGGTTCGAGCATGTCGCTTCGAACATTCTAGCTGAGAAAAGATCGGTTGCC
GATCTTAAATGGGAGGAAACCCGTGCCCGCATCATCGCTGCGTGGTGCAACCCCCATACAGTTGCCAATGCTGCG
TGTTTCCGCCAGCAGAACCAGCCAAAACCCAAATGGGACAAACAAAAACCCGATCAAGGTCAGGGTAAGTCCCAA
GGCTCTGGTTCCGGTTCTGGCTCCGGCCAGAATCAAAACAAGCAACAACAACCTCAGCAGAAGAAGAAAGCCTCT
ATCGAAGAAGTCAAGGATACCACTCCTGACTATTCCGCTTCTTCTGCCATCGCCTCGATGGCGCGGCTCACATCC
ACCTCTACTCGCGCGAAAGTTGATGAGATGAAGAGCAGATCGCCCAAGTTGGGCAACCATACTATTTCGGGTGAG
GAATTTCTTTTCTTCCCTGATGGTAATATGATTGATCTTTCCCCTCCGGATACTGACATTGACTCTTGGACTTTG
CCTCGGCTTCGTCCCGCAACGCGAAATCTCCTATCAGACAAATCTGATGTTGATCTTGATCCATCAGACTCCGGG
TCGATCCCTCGGGACCCTCGGAAACGTCCTTCCTCTTGCCATTCCCCCACACCCTACGAAAGGGCCAAAACGAAA
GTGTTATCCCTCTGGGATCAACGTCTTAACGCAGTGACTGTTACAGCCCCTCCAATCGAGGATGGGGCCGGTCAA
GTGGGTGGTAATGCTCCGGCTGTAAAAATGCCGGCTACGAAAGGAAAACAAGTTGAGAAGATGGATGTTGATAAG
GCTGATGAGATTTCTCTCGGCGATGAAGATGGAGAATTTGAGGCAGTACTGTCTCCAGAAACAAAGGCTTGGTTG
AACCAGCCTATCTCCGAGGAAGATTGGGCCGCTCTTCGTGGCTTCGATTAG
Gene >Agabi119p4|770800
ATGGTCAACGGCTCCGATAATTCGGCTTGGGAAATGAGTGGTTCCTCTGCTCCTCCTCTGCCAACCACAGATCCG
GTTGAGATACGAGCTCGTTCTCTCCTCTCGGCCCGAGCATCTGCTATTATCGAGTCCCATCTCCCAAATTCGATG
CTCAGTCAAGCGGCCGCTCAAACGGACGCTAGAGCTCTTTGGAGTTGGTTAGAAGGCCAGTACGGCCAAAAAGGA
CCGACATTCGCTTACGAGCGTTTCGTCACGGCTCAAAATTTCAAAATAAACGACTCCACCGATCCATCGTCTGCG
ATTGCAGATCTCTATGCACTATTTGCCGCTGTTGAAAGCACCGGTGCGTTGATCCATGAATTGATCCGCACCATG
ATGCTCCTCAACGCTCTCCCCAACCGGTTCGAGCATGTCGCTTCGAACATTCTAGCTGAGAAAAGATCGGTTGCC
GATCTTAAATGGGAGGAAACCCGTGCCCGCATCATCGCTGCGTGGTGCAACCCCCATACAGTTGCCAATGCTGCG
TGTTTCCGCCAGCAGAACCAGCCAAAACCCAAATGGGACAAACAAAAACCCGATCAAGGTCAGGGTAAGTCCCAA
GGCTCTGGTTCCGGTTCTGGCTCCGGCCAGAATCAAAACAAGCAACAACAACCTCAGCAGAAGAAGAAAGGTGAG
TAGCAGAATGAGAACAACAAGAAGAAGAGAACCCGCTCCCGTAAAAAGAAGCAGGGTAATGAGGCATCTACAGCC
TCTATCGAAGAAGTCAAGGATACCACTCCTGACTATTCCGCTTCTTCTGCCATCGCCTCGATGGCGCGGCTCACA
TCCACCTCTACTCGCGCGAAAGTTGATGAGATGAAGAGCAGGTTTGTCCCGCTCCCATCTAGATCAGATCCAAAT
CTAACATGGAATAGATCGCCCAAGTTGGGCAACCATACTATTTCGGGTGAGGAATTTCTTTTCTTCCCTGATGGT
AATATGATTGATCTTTCCCCTCCGGATACTGACATTGACTCTTGGACTTTGCCTCGGCTTCGTCCCGCAACGCGA
AATCTCCTATCAGACAAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTCGGGACCCTCGGAAA
CGTCCTTCCTCTTGCCATTCCCCCACACCCTACGAAAGGGCCAAAACGAAAGTGTTATCCCTCTGGGATCAACGT
CTTAACGCAGTGACTGTTACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTGGTAATGCTCCGGCTGTA
AAAATGCCGGCTACGAAAGGAAAACAAGTTGAGAAGATGGATGTTGATAAGGCTGATGAGATTTCTCTCGGCGAT
GAAGATGGAGAATTTGAGTATGAATACGATGCGGAATGCGAACCGGACAGCTTTGCGCAAGTCCCTCGCTCCTCT
ACCATATCTCAGATTAACTCATGGATTCTACAGGGCAGTACTGTCTCCAGAAACAAAGGCTTGGTTGAACCAGCC
TATCTCCGAGGAAGATTGGGCCGCTCTTCGTGGCTTCGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail