Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|770200
Gene name
Locationscaffold_12:704103..705675
Strand+
Gene length (bp)1572
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.5E-09 395 438

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 244 523 7.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|770200
MIDLSPPDTDIDSWTLPRLRPATRNLLSDESDVDLDPSDSGSIPWDPWKRPSSRHSPTPYKRAKTKVLSLWDQRL
NTVTVTAPPIEDGAGQVGSNAPAVKMPATKGKQVEKMDVDKADEISLGNEDGEFEYEYDAECEPDSFAQVPCSSS
ISQINSWILQGSTVSRNKGLVEPAYLRGRSGHSSWLQLGSSSTVSPVLYNMIANETTSLSSLLDRMNPICEVLHA
CHSNCSGCKTQKNLEKHSWLLDSGASCHFTPNLEDFAHIQRGNFGIVHTANKNSVLKIEGRGHVLIEHTVKDIST
GKEFKSVSKLWPVFYVNGMNHRLLSTAQLLKSGLKLESTKDGSTFKNEAGRAVLSAHPEGLFGGMHIVECTFLKH
SKTEPYLLNANGILRLPDYVIWHRRLGHPSNNVLKKFFEETQGVLKINIPQQKPVCDGCVRGKLTQQSFPQSEKR
ATSALELVHSDLFELPVLSYHKYKWVMTLLDDYSGLAQIVMLTKKSDAALQLINILKQSATQSDQKIKRLRTD*
Coding >Agabi119p4|770200
ATGATTGATCTTTCCCCTCCGGATACTGACATTGACTCCTGGACTTTGCCTCGGCTTCGTCCCGCAACGCGAAAT
CTCCTATCGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTTGGGACCCTTGGAAACGT
CCTTCCTCTCGCCATTCCCCCACGCCCTACAAAAGGGCCAAAACGAAAGTGTTATCCCTCTGGGATCAACGTCTT
AACACAGTGACTGTAACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTAGTAATGCTCCGGCTGTAAAA
ATGCCGGCTACGAAAGGAAAACAAGTTGAGAAGATGGATGTTGATAAGGCTGATGAGATTTCTCTCGGCAATGAA
GATGGAGAATTTGAGTATGAATACGATGCGGAATGCGAACCGGACAGCTTTGCGCAAGTCCCTTGCTCCTCTTCC
ATATCTCAGATTAACTCATGGATTCTACAGGGCAGTACTGTCTCCAGAAACAAAGGTTTGGTTGAACCAGCCTAT
CTCCGAGGAAGATCGGGCCACTCTTCGTGGCTTCAATTAGGATCGTCGAGTACCGTTTCCCCTGTATTATATAAT
ATGATCGCGAATGAGACAACTTCTTTATCCTCTTTGCTTGATCGAATGAATCCAATATGTGAAGTTCTCCATGCC
TGTCATTCGAACTGTTCGGGTTGCAAAACCCAAAAGAATCTAGAAAAACATAGTTGGTTGCTCGATAGTGGCGCT
TCGTGCCACTTCACGCCGAACCTCGAAGATTTCGCACATATACAACGAGGAAACTTCGGTATCGTGCACACTGCA
AACAAAAACTCCGTGCTCAAAATAGAGGGCCGCGGACATGTTTTAATCGAGCATACCGTAAAAGATATCTCCACG
GGAAAAGAGTTTAAATCTGTATCAAAGCTCTGGCCCGTGTTCTATGTCAACGGAATGAATCATAGACTTCTTTCG
ACTGCTCAATTGTTGAAGTCTGGACTTAAACTAGAGTCCACAAAAGATGGATCTACCTTCAAAAACGAGGCAGGT
CGAGCGGTTCTTAGTGCCCATCCGGAAGGTCTTTTCGGTGGAATGCACATTGTTGAGTGTACCTTCTTAAAACAC
TCCAAAACAGAACCATATTTGCTCAATGCAAACGGAATCCTCCGGCTCCCTGACTACGTCATTTGGCATCGTAGA
TTAGGTCATCCTTCTAATAATGTGTTGAAGAAATTCTTCGAGGAAACGCAAGGAGTACTGAAAATTAATATTCCA
CAACAGAAACCGGTTTGTGATGGTTGTGTTCGTGGCAAACTTACACAACAATCATTTCCACAATCGGAAAAACGT
GCTACTTCAGCGCTCGAACTGGTCCACTCGGATCTATTCGAACTCCCCGTCCTCTCTTATCACAAATATAAATGG
GTGATGACTTTGCTTGATGACTATTCTGGTCTCGCTCAGATCGTCATGTTAACCAAGAAAAGTGATGCCGCGTTA
CAGTTGATTAATATCCTAAAACAGTCGGCTACTCAATCTGATCAAAAGATCAAAAGATTGCGTACAGATTGA
Transcript >Agabi119p4|770200
ATGATTGATCTTTCCCCTCCGGATACTGACATTGACTCCTGGACTTTGCCTCGGCTTCGTCCCGCAACGCGAAAT
CTCCTATCGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTTGGGACCCTTGGAAACGT
CCTTCCTCTCGCCATTCCCCCACGCCCTACAAAAGGGCCAAAACGAAAGTGTTATCCCTCTGGGATCAACGTCTT
AACACAGTGACTGTAACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTAGTAATGCTCCGGCTGTAAAA
ATGCCGGCTACGAAAGGAAAACAAGTTGAGAAGATGGATGTTGATAAGGCTGATGAGATTTCTCTCGGCAATGAA
GATGGAGAATTTGAGTATGAATACGATGCGGAATGCGAACCGGACAGCTTTGCGCAAGTCCCTTGCTCCTCTTCC
ATATCTCAGATTAACTCATGGATTCTACAGGGCAGTACTGTCTCCAGAAACAAAGGTTTGGTTGAACCAGCCTAT
CTCCGAGGAAGATCGGGCCACTCTTCGTGGCTTCAATTAGGATCGTCGAGTACCGTTTCCCCTGTATTATATAAT
ATGATCGCGAATGAGACAACTTCTTTATCCTCTTTGCTTGATCGAATGAATCCAATATGTGAAGTTCTCCATGCC
TGTCATTCGAACTGTTCGGGTTGCAAAACCCAAAAGAATCTAGAAAAACATAGTTGGTTGCTCGATAGTGGCGCT
TCGTGCCACTTCACGCCGAACCTCGAAGATTTCGCACATATACAACGAGGAAACTTCGGTATCGTGCACACTGCA
AACAAAAACTCCGTGCTCAAAATAGAGGGCCGCGGACATGTTTTAATCGAGCATACCGTAAAAGATATCTCCACG
GGAAAAGAGTTTAAATCTGTATCAAAGCTCTGGCCCGTGTTCTATGTCAACGGAATGAATCATAGACTTCTTTCG
ACTGCTCAATTGTTGAAGTCTGGACTTAAACTAGAGTCCACAAAAGATGGATCTACCTTCAAAAACGAGGCAGGT
CGAGCGGTTCTTAGTGCCCATCCGGAAGGTCTTTTCGGTGGAATGCACATTGTTGAGTGTACCTTCTTAAAACAC
TCCAAAACAGAACCATATTTGCTCAATGCAAACGGAATCCTCCGGCTCCCTGACTACGTCATTTGGCATCGTAGA
TTAGGTCATCCTTCTAATAATGTGTTGAAGAAATTCTTCGAGGAAACGCAAGGAGTACTGAAAATTAATATTCCA
CAACAGAAACCGGTTTGTGATGGTTGTGTTCGTGGCAAACTTACACAACAATCATTTCCACAATCGGAAAAACGT
GCTACTTCAGCGCTCGAACTGGTCCACTCGGATCTATTCGAACTCCCCGTCCTCTCTTATCACAAATATAAATGG
GTGATGACTTTGCTTGATGACTATTCTGGTCTCGCTCAGATCGTCATGTTAACCAAGAAAAGTGATGCCGCGTTA
CAGTTGATTAATATCCTAAAACAGTCGGCTACTCAATCTGATCAAAAGATCAAAAGATTGCGTACAGATTGA
Gene >Agabi119p4|770200
ATGATTGATCTTTCCCCTCCGGATACTGACATTGACTCCTGGACTTTGCCTCGGCTTCGTCCCGCAACGCGAAAT
CTCCTATCGGACGAATCTGATGTTGATCTTGATCCATCAGACTCCGGGTCGATCCCTTGGGACCCTTGGAAACGT
CCTTCCTCTCGCCATTCCCCCACGCCCTACAAAAGGGCCAAAACGAAAGTGTTATCCCTCTGGGATCAACGTCTT
AACACAGTGACTGTAACAGCCCCTCCAATCGAGGATGGGGCCGGTCAAGTGGGTAGTAATGCTCCGGCTGTAAAA
ATGCCGGCTACGAAAGGAAAACAAGTTGAGAAGATGGATGTTGATAAGGCTGATGAGATTTCTCTCGGCAATGAA
GATGGAGAATTTGAGTATGAATACGATGCGGAATGCGAACCGGACAGCTTTGCGCAAGTCCCTTGCTCCTCTTCC
ATATCTCAGATTAACTCATGGATTCTACAGGGCAGTACTGTCTCCAGAAACAAAGGTTTGGTTGAACCAGCCTAT
CTCCGAGGAAGATCGGGCCACTCTTCGTGGCTTCAATTAGGATCGTCGAGTACCGTTTCCCCTGTATTATATAAT
ATGATCGCGAATGAGACAACTTCTTTATCCTCTTTGCTTGATCGAATGAATCCAATATGTGAAGTTCTCCATGCC
TGTCATTCGAACTGTTCGGGTTGCAAAACCCAAAAGAATCTAGAAAAACATAGTTGGTTGCTCGATAGTGGCGCT
TCGTGCCACTTCACGCCGAACCTCGAAGATTTCGCACATATACAACGAGGAAACTTCGGTATCGTGCACACTGCA
AACAAAAACTCCGTGCTCAAAATAGAGGGCCGCGGACATGTTTTAATCGAGCATACCGTAAAAGATATCTCCACG
GGAAAAGAGTTTAAATCTGTATCAAAGCTCTGGCCCGTGTTCTATGTCAACGGAATGAATCATAGACTTCTTTCG
ACTGCTCAATTGTTGAAGTCTGGACTTAAACTAGAGTCCACAAAAGATGGATCTACCTTCAAAAACGAGGCAGGT
CGAGCGGTTCTTAGTGCCCATCCGGAAGGTCTTTTCGGTGGAATGCACATTGTTGAGTGTACCTTCTTAAAACAC
TCCAAAACAGAACCATATTTGCTCAATGCAAACGGAATCCTCCGGCTCCCTGACTACGTCATTTGGCATCGTAGA
TTAGGTCATCCTTCTAATAATGTGTTGAAGAAATTCTTCGAGGAAACGCAAGGAGTACTGAAAATTAATATTCCA
CAACAGAAACCGGTTTGTGATGGTTGTGTTCGTGGCAAACTTACACAACAATCATTTCCACAATCGGAAAAACGT
GCTACTTCAGCGCTCGAACTGGTCCACTCGGATCTATTCGAACTCCCCGTCCTCTCTTATCACAAATATAAATGG
GTGATGACTTTGCTTGATGACTATTCTGGTCTCGCTCAGATCGTCATGTTAACCAAGAAAAGTGATGCCGCGTTA
CAGTTGATTAATATCCTAAAACAGTCGGCTACTCAATCTGATCAAAAGATCAAAAGATTGCGTACAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail