Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|768300
Gene name
Locationscaffold_12:369930..371341
Strand-
Gene length (bp)1411
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88 5.0E-59 51 361

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34559|URHG2_BACSU Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) GN=yteR PE=1 SV=1 54 342 3.0E-46
sp|P0A3U7|PIC1_RHIRD 24.9 kDa protein in picA locus OS=Rhizobium radiobacter PE=2 SV=1 210 366 5.0E-15
sp|P0A3U6|PIC1_AGRFC Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu3128 PE=3 SV=1 210 366 5.0E-15
sp|O31521|URHG1_BACSU Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) GN=yesR PE=1 SV=1 61 338 3.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|768300
MVFSSSSFTLLTLFIVISTVCARPQSYAIWAADSGIQRQQGNGLGGDGNPDVSYEHGEFQWGLRQLYERTGEEKY
FEYIKNGVDNIVFGNGTVHGNYRLSDFSLDPVRTGPSFLYLLGKTGERKYQIAADIFKSQLDSHPRTAQGQFWHK
LRYPNQGWLDGIYMGDIFYADYTKRFQPDNTTAWDDIAKQFTLMYQNALQNATAPNNLHLLYHGYDFSHQKVWAS
PDRGHSPEVWDRALGWFSMALVDILETFPQDHPGYQSILSILQDVVPHIRDAADPSTGVWWLVMTQPGREKNYFE
SSGGAMFVYSMLKSLRLGFVKDTEDGSIARAAKKAYGYMTENWVVEKQDGTMDWLNTVIVRGLQIFF*
Coding >Agabi119p4|768300
ATGGTTTTCTCATCATCGAGTTTTACACTGCTCACACTTTTCATAGTCATATCCACTGTTTGTGCTCGTCCACAG
TCTTATGCCATATGGGCAGCCGACTCGGGTATACAGCGACAACAAGGAAATGGTCTTGGTGGGGATGGGAATCCT
GATGTATCTTATGAGCATGGAGAGTTTCAGTGGGGGTTGAGACAGCTTTATGAAAGGACGGGGGAGGAGAAGTAT
TTTGAGTATATAAAAAACGGGGTGGATAATATTGTTTTTGGGAACGGGACTGTGCATGGGAATTATAGGTTGAGC
GATTTTAGTCTTGACCCGGTAAGAACCGGTCCTTCGTTCCTTTATCTTCTCGGAAAAACGGGTGAAAGGAAATAT
CAAATCGCTGCGGATATATTCAAATCCCAACTGGATTCTCATCCCCGTACGGCTCAAGGACAGTTTTGGCATAAA
CTCAGATATCCGAATCAAGGTTGGCTTGATGGGATATATATGGGTGATATTTTCTATGCGGATTATACGAAACGA
TTCCAACCAGATAATACTACAGCTTGGGATGATATCGCGAAACAATTCACTTTGATGTATCAAAACGCCCTTCAA
AATGCTACTGCACCCAATAACCTCCATCTCTTATATCACGGATACGATTTTTCTCATCAAAAAGTATGGGCATCC
CCAGATAGAGGTCATTCACCTGAGGTTTGGGATCGCGCTTTGGGATGGTTTTCAATGGCTCTCGTCGACATTCTC
GAAACATTCCCACAAGATCACCCAGGATATCAATCTATCTTGTCAATTTTACAAGACGTTGTACCTCACATCCGA
GATGCCGCGGACCCTTCTACTGGAGTTTGGTGGTTAGTGATGACTCAACCTGGGAGAGAGAAAAATTATTTTGAG
AGTAGTGGGGGTGCGATGTTTGTTTATTCGATGTTGAAGAGTTTGAGGTTGGGTTTCGTGAAGGATACGGAGGAT
GGGAGTATTGCTAGGGCGGCGAAGAAGGCGTATGGCTATATGACAGAGAATTGGGTTGTGGAGAAGCAGGATGGA
ACTATGGACTGGTTGAATACCGTCATCGTGCGTGGTTTACAAATTTTCTTTTAG
Transcript >Agabi119p4|768300
ATGGTTTTCTCATCATCGAGTTTTACACTGCTCACACTTTTCATAGTCATATCCACTGTTTGTGCTCGTCCACAG
TCTTATGCCATATGGGCAGCCGACTCGGGTATACAGCGACAACAAGGAAATGGTCTTGGTGGGGATGGGAATCCT
GATGTATCTTATGAGCATGGAGAGTTTCAGTGGGGGTTGAGACAGCTTTATGAAAGGACGGGGGAGGAGAAGTAT
TTTGAGTATATAAAAAACGGGGTGGATAATATTGTTTTTGGGAACGGGACTGTGCATGGGAATTATAGGTTGAGC
GATTTTAGTCTTGACCCGGTAAGAACCGGTCCTTCGTTCCTTTATCTTCTCGGAAAAACGGGTGAAAGGAAATAT
CAAATCGCTGCGGATATATTCAAATCCCAACTGGATTCTCATCCCCGTACGGCTCAAGGACAGTTTTGGCATAAA
CTCAGATATCCGAATCAAGGTTGGCTTGATGGGATATATATGGGTGATATTTTCTATGCGGATTATACGAAACGA
TTCCAACCAGATAATACTACAGCTTGGGATGATATCGCGAAACAATTCACTTTGATGTATCAAAACGCCCTTCAA
AATGCTACTGCACCCAATAACCTCCATCTCTTATATCACGGATACGATTTTTCTCATCAAAAAGTATGGGCATCC
CCAGATAGAGGTCATTCACCTGAGGTTTGGGATCGCGCTTTGGGATGGTTTTCAATGGCTCTCGTCGACATTCTC
GAAACATTCCCACAAGATCACCCAGGATATCAATCTATCTTGTCAATTTTACAAGACGTTGTACCTCACATCCGA
GATGCCGCGGACCCTTCTACTGGAGTTTGGTGGTTAGTGATGACTCAACCTGGGAGAGAGAAAAATTATTTTGAG
AGTAGTGGGGGTGCGATGTTTGTTTATTCGATGTTGAAGAGTTTGAGGTTGGGTTTCGTGAAGGATACGGAGGAT
GGGAGTATTGCTAGGGCGGCGAAGAAGGCGTATGGCTATATGACAGAGAATTGGGTTGTGGAGAAGCAGGATGGA
ACTATGGACTGGTTGAATACCGTCATCGTGCGTGGTTTACAAATTTTCTTTTAG
Gene >Agabi119p4|768300
ATGGTTTTCTCATCATCGAGTTTTACACTGCTCACACTTTTCATAGTCATATCCACTGTTTGTGCTCGTCCACAG
TCTTATGCCATATGGGCAGCCGACTCGGGTATACAGCGACAACAAGGAAATGGTCTTGGTGGGGATGGGAATCCT
GATGTATCTTATGAGCATGGAGAGTTTCAGTGGGGGTTGAGACAGCTTTATGAAAGGACGGGGGAGGAGAAGTAT
TTTGAGTATATAAAAAACGGGGTGGATAATATTGTTTTTGGGAACGGGACTGTGCATGGGAATTATAGGTGTGTT
TTTTAGCTTGTCGGAGGAAGATTTAGTTGCTTTTTTTTTTACTTGGTGTTTAGGTTGAGCGATTTTAGTCTTGAC
CCGGTAAGGTGAGCCTGGTTTATATGCGAATGTTTTTTTTTCGAATACCGAACTCATTTGACTTATAGAACCGGT
CCTTCGTTCCTTTATCTGTAAGCCATTTTCATAGCCCTTCCTATCCTTTGTATAGGGCTCAAAGTCCTTTTTCTT
TCTTTTCTTTTCTTTTGTAGTCTCGGAAAAACGGGTGAAAGGAAATATCAAATCGCTGCGGATATATTCAAATCC
CAACTGGATTCTCATCCCCGTACGGCTCAAGGACAGTTTTGGCATAAACTCAGATATCCGAATCAAGGTGGGCAT
TTGAGAAGAAAGGAAAAGAAAAGGATTAACTGGCTTTTTTTTTGATTATAGGTTGGCTTGATGGGATATATATGG
GTGATATTTTCTATGCGGATTATACGAAACGATTCCAACCAGATAATACTACAGCTTGGGGTACGAACTTCTTTC
TTTTTTTTATACCTTTCTTTTAAAGTGCGAAATAGATGATATCGCGAAACAATTCACTTTGATGTATCAAAACGC
CCTTCAAAATGCTACTGCACCCAATAACCTCCATCTCTTATATCACGGATACGATTTTTCTCATCAAAAAGTATG
GGCATCCCCAGATAGAGGTCATTCACCTGAGGTTTGGGATCGCGCTTTGGGATGGTTTTCAATGGCTCTCGTCGA
CATTCTCGAAACATTCCCACAAGATCACCCAGGATATCAATCTATCTTGTCAATTTTACAAGACGTTGTACCTCA
CATCCGAGATGCCGCGGACCCTTCTACTGGAGTTTGGTGGTTAGTGATGACTCAACCTGGGAGAGAGAAAAATTA
TTTTGAGAGTAGTGGGGGTGCGATGTTTGTTTATTCGATGTTGAAGAGTTTGAGGTTGGGTTTCGTGAAGGATAC
GGAGGATGGGAGTATTGCTAGGGCGGCGAAGAAGGCGTATGGCTATATGACAGAGAATTGGGTTGTGGAGAAGCA
GGATGGAACTATGGACTGGTTGAATACCGTCATCGTGCGTGGTTTACAAATTTTCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail