Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|767200
Gene name
Locationscaffold_12:260119..263089
Strand-
Gene length (bp)2970
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 3.3E-13 213 293
PF17123 zf-RING_11 RING-like zinc finger 1.2E-11 362 390
PF13639 zf-RING_2 Ring finger domain 3.4E-08 362 407
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.1E-04 363 406

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10322|DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dma1 PE=1 SV=1 154 417 2.0E-57
sp|P38823|DMA1_YEAST E3 ubiquitin-protein ligase DMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA1 PE=1 SV=1 180 413 2.0E-51
sp|P53924|DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA2 PE=1 SV=1 180 413 3.0E-50
sp|A6ZRW7|DMA2_YEAS7 E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DMA2 PE=3 SV=1 180 413 4.0E-50
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS=Oryctolagus cuniculus GN=SLMAP PE=1 SV=2 205 303 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10322|DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dma1 PE=1 SV=1 154 417 2.0E-57
sp|P38823|DMA1_YEAST E3 ubiquitin-protein ligase DMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA1 PE=1 SV=1 180 413 2.0E-51
sp|P53924|DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA2 PE=1 SV=1 180 413 3.0E-50
sp|A6ZRW7|DMA2_YEAS7 E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DMA2 PE=3 SV=1 180 413 4.0E-50
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS=Oryctolagus cuniculus GN=SLMAP PE=1 SV=2 205 303 2.0E-13
sp|Q14BN4|SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens GN=SLMAP PE=1 SV=1 205 303 3.0E-13
sp|P0C219|SLMAP_RAT Sarcolemmal membrane-associated protein OS=Rattus norvegicus GN=Slmap PE=1 SV=1 205 303 1.0E-12
sp|O74388|YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.13 PE=1 SV=1 209 313 1.0E-12
sp|Q3URD3|SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus GN=Slmap PE=1 SV=2 205 303 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|767200
MEPESPPSRTTILSSLLRGRPRNSSQSHANAADNHNHELSPPPPLSPSPAPLGSRNRRTQAQAAAPATAAQMQPS
TSQPQQSAGLAISQMLRRRRSAGNVQQQQSQNQNSNQAQHSGHAPPHIMSQTAQTGLALAGFNVESSQTASNPTS
HGPQSTQGPSAPQAAAAHSQSNNATASHRIRLVPQLDSRRSLRFDPIGRDLRESDPPLRIGRFTDRSGLGLSAIN
SINSNKLAFRSKVVSRAHAEIWVDGGGKFFIRDTKSSSGTFLNHVRLSSAGTESRPFQIKDGDFLQLGVDYQGGT
EDIYKSVKIRVEIGREWQAGVNAFNTNAFKNIKALTLPATASAAAQSTTNNSGRTKNLGIPDCCICLFSVTIRQA
LFIAPCSHAFHYKCIKPVLESHHPAFSCPLCRTFADLEEDVEVDEGSWECGSDVEKLIGDSALPSPLPGGGRADD
GDDRMDVDGIIHPNARASGEERPAVVPEEPEEDEGVVNPFQGGRPSVSPNPEGVLSGDDDSDMAQVTATVQRQES
PLPPNSIPISNSITPPVQGNLGTGNNGSSAVWGSPGAESTSESARGDSPVLVNVIGGPGQGAQIAIAAGGGGDGD
GDMGMGGDTVGIEGETVGGKRKR*
Coding >Agabi119p4|767200
ATGGAACCAGAGTCTCCGCCGTCGCGCACAACAATCCTGAGCTCGTTGCTCAGAGGCAGACCCAGAAACTCGTCT
CAGAGCCATGCAAATGCCGCAGACAACCACAACCACGAGCTTTCACCGCCACCACCACTGTCGCCCTCCCCAGCG
CCTCTCGGCTCCCGCAACCGCCGTACTCAAGCACAGGCTGCAGCGCCCGCAACCGCGGCCCAGATGCAGCCCTCG
ACCTCGCAGCCACAGCAGTCGGCGGGCCTGGCCATCTCCCAAATGCTTCGCCGCAGACGATCAGCGGGAAACGTC
CAACAACAACAAAGTCAGAATCAAAATTCAAACCAGGCCCAGCATTCAGGCCATGCTCCTCCTCATATAATGTCC
CAGACTGCGCAGACTGGGTTGGCCCTCGCAGGGTTCAACGTCGAATCATCTCAGACGGCGTCTAATCCGACATCA
CACGGTCCACAGTCAACGCAAGGGCCCTCCGCGCCACAAGCAGCAGCAGCCCATTCTCAGTCGAATAACGCTACT
GCATCCCACCGCATCCGACTCGTCCCCCAGCTCGACTCCCGCCGTTCTCTCCGCTTTGACCCTATCGGTCGAGAT
CTTCGTGAAAGTGATCCTCCCCTCCGTATCGGTCGTTTCACAGATCGTTCCGGATTGGGTCTCTCTGCCATCAAC
TCCATCAATTCCAACAAGCTTGCTTTCAGATCCAAAGTCGTCTCTAGAGCTCATGCGGAAATTTGGGTTGATGGT
GGTGGCAAATTTTTTATCCGGGATACGAAGAGCAGTTCCGGGACTTTTCTGAATCATGTGAGGCTGAGTTCGGCG
GGAACGGAAAGCAGACCATTTCAGATAAAGGATGGAGACTTTTTGCAGCTCGGCGTAGACTATCAAGGAGGAACA
GAGGATATTTATAAAAGTGTGAAGATTAGAGTCGAGATTGGGAGGGAGTGGCAGGCGGGAGTGAATGCTTTCAAC
ACGAATGCCTTCAAAAATATAAAGGCCCTTACTCTACCAGCGACTGCTTCCGCAGCGGCACAATCTACTACCAAT
AACTCTGGAAGAACCAAAAATCTAGGTATTCCAGATTGTTGCATTTGTTTATTCAGTGTAACCATCCGTCAAGCA
CTTTTCATTGCGCCATGCTCTCATGCTTTCCACTATAAATGCATAAAACCAGTTCTTGAATCTCATCATCCAGCA
TTTTCATGCCCTTTATGTCGAACTTTCGCGGATCTAGAAGAGGACGTGGAAGTTGATGAAGGAAGTTGGGAATGT
GGTAGTGACGTAGAGAAATTGATTGGGGATAGTGCTCTACCGTCTCCATTGCCAGGAGGTGGAAGAGCGGACGAC
GGGGACGATAGAATGGATGTGGACGGGATCATTCATCCGAATGCAAGGGCATCCGGCGAGGAGAGACCTGCGGTT
GTACCTGAAGAACCGGAGGAAGATGAAGGTGTTGTCAATCCTTTCCAAGGTGGCAGGCCATCAGTGTCACCCAAT
CCCGAAGGTGTACTCTCTGGTGATGACGATTCTGATATGGCACAAGTAACAGCGACAGTTCAACGTCAAGAATCT
CCACTTCCGCCCAACAGTATTCCCATCAGCAACTCGATTACCCCTCCAGTTCAGGGCAATCTCGGTACAGGAAAC
AACGGTTCAAGCGCGGTATGGGGAAGTCCAGGAGCTGAATCAACAAGTGAGTCTGCGAGAGGTGATTCACCGGTT
TTAGTGAATGTTATCGGTGGACCAGGTCAAGGGGCTCAGATTGCTATTGCTGCGGGTGGTGGTGGTGATGGAGAT
GGTGATATGGGAATGGGGGGAGATACGGTTGGGATTGAGGGTGAGACTGTTGGTGGGAAACGGAAACGATGA
Transcript >Agabi119p4|767200
ATGGAACCAGAGTCTCCGCCGTCGCGCACAACAATCCTGAGCTCGTTGCTCAGAGGCAGACCCAGAAACTCGTCT
CAGAGCCATGCAAATGCCGCAGACAACCACAACCACGAGCTTTCACCGCCACCACCACTGTCGCCCTCCCCAGCG
CCTCTCGGCTCCCGCAACCGCCGTACTCAAGCACAGGCTGCAGCGCCCGCAACCGCGGCCCAGATGCAGCCCTCG
ACCTCGCAGCCACAGCAGTCGGCGGGCCTGGCCATCTCCCAAATGCTTCGCCGCAGACGATCAGCGGGAAACGTC
CAACAACAACAAAGTCAGAATCAAAATTCAAACCAGGCCCAGCATTCAGGCCATGCTCCTCCTCATATAATGTCC
CAGACTGCGCAGACTGGGTTGGCCCTCGCAGGGTTCAACGTCGAATCATCTCAGACGGCGTCTAATCCGACATCA
CACGGTCCACAGTCAACGCAAGGGCCCTCCGCGCCACAAGCAGCAGCAGCCCATTCTCAGTCGAATAACGCTACT
GCATCCCACCGCATCCGACTCGTCCCCCAGCTCGACTCCCGCCGTTCTCTCCGCTTTGACCCTATCGGTCGAGAT
CTTCGTGAAAGTGATCCTCCCCTCCGTATCGGTCGTTTCACAGATCGTTCCGGATTGGGTCTCTCTGCCATCAAC
TCCATCAATTCCAACAAGCTTGCTTTCAGATCCAAAGTCGTCTCTAGAGCTCATGCGGAAATTTGGGTTGATGGT
GGTGGCAAATTTTTTATCCGGGATACGAAGAGCAGTTCCGGGACTTTTCTGAATCATGTGAGGCTGAGTTCGGCG
GGAACGGAAAGCAGACCATTTCAGATAAAGGATGGAGACTTTTTGCAGCTCGGCGTAGACTATCAAGGAGGAACA
GAGGATATTTATAAAAGTGTGAAGATTAGAGTCGAGATTGGGAGGGAGTGGCAGGCGGGAGTGAATGCTTTCAAC
ACGAATGCCTTCAAAAATATAAAGGCCCTTACTCTACCAGCGACTGCTTCCGCAGCGGCACAATCTACTACCAAT
AACTCTGGAAGAACCAAAAATCTAGGTATTCCAGATTGTTGCATTTGTTTATTCAGTGTAACCATCCGTCAAGCA
CTTTTCATTGCGCCATGCTCTCATGCTTTCCACTATAAATGCATAAAACCAGTTCTTGAATCTCATCATCCAGCA
TTTTCATGCCCTTTATGTCGAACTTTCGCGGATCTAGAAGAGGACGTGGAAGTTGATGAAGGAAGTTGGGAATGT
GGTAGTGACGTAGAGAAATTGATTGGGGATAGTGCTCTACCGTCTCCATTGCCAGGAGGTGGAAGAGCGGACGAC
GGGGACGATAGAATGGATGTGGACGGGATCATTCATCCGAATGCAAGGGCATCCGGCGAGGAGAGACCTGCGGTT
GTACCTGAAGAACCGGAGGAAGATGAAGGTGTTGTCAATCCTTTCCAAGGTGGCAGGCCATCAGTGTCACCCAAT
CCCGAAGGTGTACTCTCTGGTGATGACGATTCTGATATGGCACAAGTAACAGCGACAGTTCAACGTCAAGAATCT
CCACTTCCGCCCAACAGTATTCCCATCAGCAACTCGATTACCCCTCCAGTTCAGGGCAATCTCGGTACAGGAAAC
AACGGTTCAAGCGCGGTATGGGGAAGTCCAGGAGCTGAATCAACAAGTGAGTCTGCGAGAGGTGATTCACCGGTT
TTAGTGAATGTTATCGGTGGACCAGGTCAAGGGGCTCAGATTGCTATTGCTGCGGGTGGTGGTGGTGATGGAGAT
GGTGATATGGGAATGGGGGGAGATACGGTTGGGATTGAGGGTGAGACTGTTGGTGGGAAACGGAAACGATGA
Gene >Agabi119p4|767200
ATGGAACCAGAGTCTCCGCCGTCGCGCACAACAATCCTGAGCTCGTTGCTCAGAGGCAGACCCAGAAACTCGTCT
CAGAGCCATGCAAATGCCGCAGACAACCACAACCACGAGCTTTCACCGCCACCACCACTGTCGCCCTCCCCAGCG
CCTCTCGGCTCCCGCAACCGCCGTACTCAAGCACAGGCTGCAGCGCCCGCAACCGCGGCCCAGATGCAGCCCTCG
ACCTCGCAGCCACAGCAGTCGGCGGGCCTGGCCATCTCCCAAATGCTTCGCCGCAGACGATCAGCGGGAAACGTC
CAACAACAACAAAGTCAGAATCAAAATTCAAACCAGGCCCAGCATTCAGGCCATGCTCCTCCTCATATAATGTCC
CAGACTGCGCAGACTGGGTTGGCCCTCGCAGGGTTCAACGTCGAATCATCTCAGACGGCGTCTAATCCGACATCA
CACGGTCCACAGTCAACGCAAGGGCCCTCCGCGCCACAAGCAGCAGCAGCCCATTCTCAGTCGAATAACGCTACT
GCATCCCACCGCATCCGACTCGTCCCCCAGCTCGACTCCCGCCGTTCTCTCCGCTTTGACCCTATCGGTCGAGAT
CTTCGTGAAAGTGATCCTCCCCTCCGTATCGGTCGTTTCACAGATCGTTCCGGATTGGGTCTCTCTGCCATCAAC
TCCATCAATTCCAACAAGCTTGCTTTCAGATCCAAAGTCGTCTCTAGAGCTCATGCGGAAATTTGGGTTGATGGT
GGTGGCAAATTTTTTATCCGGGATACGAAGAGCAGTTCCGGGACTTTTCTGAATCATGTGAGGCTGAGTTCGGCG
GGAACGGAAAGCAGACCATTTCAGATAAAGGATGGAGACTTTTTGCAGCTCGGCGTAGACTATCAAGGAGGAACA
GAGGATATTTATAAAAGTGTGAAGATTAGAGTCGAGATTGGGAGGGAGTGGCAGGCGGGAGTGAATGCTTTCAAG
TTAGCCTTGATTCTCCTGAGGAGACACCGTCTAACCCTACTTCTAGCACGAATGCCTTCAAAAATATAAAGGCCC
TTACTCTACCAGCGACTGCTTCCGCAGCGGCACAATCTACTACCAATAACTCTGGAAGAACCAAAAATCTAGGTA
TTCCAGATTGTTGCATTTGTACGTCAAACATGACTTTCCTCACGACTTCCTTGTCCATTAAATTGACCTTGTACA
GGTTTATTCAGTGTAACCATCCGTCAAGCACTTTTCATTGCGCCATGCTCTCATGCTTTCCACTATAAATGCATA
AAACCAGTTCTTGAATCTCATCATCCAGCATTTTCATGCCCTTTATGTCGAACTTTCGCGGATCTAGAAGAGGAC
GTGGAAGTTGATGAAGGAAGTTGGGAATGTGGTAGTGACGTAGAGAAATTGATTGGGGATAGTGCTCTACCGTCT
CCATTGCCAGGAGGTGGAAGAGCGGACGACGGGGACGATAGAATGGATGTGGACGGGATCATTCATCCGAATGCA
AGGGCATCCGGCGAGGAGAGACCTGCGGTTGTACCTGAAGAACCGGAGGAAGATGAAGGTGGTGAGTAGATGTTC
TTGTCCACCTCTCAAATTTTTTCCCTTCTCCTTTTTCCGATTTGTTATCTTTTGTCTTTCCTGTCTTTCCTGGGC
GTTACTGCGGCTCGCTTCCACTTTCATCCTTATACGAAGCGCTACTGCCCTGCTCCGCTTTCCCATTTGGGACAT
CTTAGGCCCGTTATTGTGTCACCGTGCCCGCGCCGCACAGAATTGTGCCACACCTCGCATCTCTACCACTTCTTT
GTGACCCTTTCCTGTTTTCTCCACTCTGTGCTCATTAGCTTCGGGAGGCATACCCGAACCTGTCTTTTTGTGGCA
CTGATGATGGACACTGCCATCGTCGGTTGTTGGCGAGGATTAGCAAATGACATTCGATATGACGGGATAGCAATC
AAATTAAATGTCACACTATCCATCACATGGAAGTTGATGGACGGCACCGCGGCATTGAGCATGGTTCTTGGACCT
TCATTTCTTCTTCTGTTTACTTGGGTCTAGAGATGTTAAGAAGAGGCGCTCTGGGTTCTGTTCCAGAGTACCTCG
GGCTCAAGGGTCCTATTGCTGTTTTCATTTCATCTTTCGTGCACGGCCTATGTCGTCACCCTTTTTCTTCGTTTT
GATGCAAAGCGTGGTATGGCAGATTGTTTATATGGCAATTTGCGTGTGTTGTATCGGAGTCGGGTGGATACCTTG
ATTTCTCATGTTTCTTTTGTTGACGGTGATGAAGTGGGTCTTTTTTTGGTTTATTTGGACTAGCGTTACACCGTG
CTAGGCGTAATTCAGGATGGAGTTGATCGCCGTGTTATTCGTCTATTTTTGCTTCGGTGCGGGGGCACTCACCCG
AAGTGTGGGGCGACTTCGGTTATCTATTTTCAGCACCTCGTTTTTTTCTACTTCTTGTTTTCTCCTTCGAATCGT
CTCGTCTCGTTTTCATTTCGAACTTCATTATTATGACTCTTTGGAATTTTGTGTCACACATACTCACGACCTGTT
AAAGTTGTCAATCCTTTCCAAGGTGGCAGGCCATCAGTGTCACCCAATCCCGAAGGTGTACTCTCTGGTGATGAC
GATTCTGATATGGCACAAGTAACAGCGACAGTTCAACGTCAAGAATCTCCACTTCCGCCCAACAGTATTCCCATC
AGCAACTCGATTACCCCTCCAGTTCAGGGCAATCTCGGTACAGGAAACAACGGTTCAAGCGCGGTATGGGGAAGT
CCAGGAGCTGAATCAACAAGTGAGTCTGCGAGAGGTGATTCACCGGTTTTAGTGAATGTTATCGGTGGACCAGGT
CAAGGGGCTCAGATTGCTATTGCTGCGGGTGGTGGTGGTGATGGAGATGGTGATATGGGAATGGGGGGAGATACG
GTTGGGATTGAGGGTGAGACTGTTGGTGGGAAACGGAAACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail