Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|763100
Gene name
Locationscaffold_11:1760153..1764040
Strand+
Gene length (bp)3887
Transcript length (bp)3828
Coding sequence length (bp)3828
Protein length (aa) 1276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 6.3E-34 678 783
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 2.0E-30 652 752
PF17921 Integrase_H2C2 Integrase zinc binding domain 4.5E-20 897 955
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.8E-09 516 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 368 1253 2.0E-146
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 368 1253 2.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 368 1253 2.0E-146
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 368 1253 2.0E-146
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 368 1253 6.0E-146
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 368 1253 6.0E-146
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 368 1253 1.0E-145
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 392 1240 2.0E-129
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 392 1260 2.0E-128
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 405 1196 1.0E-78
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 402 1129 1.0E-74
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 382 1004 2.0E-67
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 383 1004 7.0E-64
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 383 803 9.0E-52
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 349 803 2.0E-40
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 396 803 1.0E-39
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 396 803 1.0E-39
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 396 803 6.0E-39
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 396 803 6.0E-38
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 349 801 3.0E-37
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 396 803 4.0E-36
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 420 803 7.0E-30
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 454 821 2.0E-28
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 402 737 3.0E-28
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 412 803 3.0E-27
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 405 737 9.0E-27
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 468 804 1.0E-26
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 402 737 3.0E-26
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 397 716 4.0E-25
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 404 783 4.0E-25
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 412 803 1.0E-24
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 904 1226 2.0E-24
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 396 814 2.0E-24
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 403 723 2.0E-24
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 397 716 5.0E-24
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 450 804 8.0E-24
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 401 816 8.0E-24
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 397 716 9.0E-24
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 397 716 1.0E-23
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 397 716 1.0E-23
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 399 807 1.0E-23
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 401 816 2.0E-23
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 397 716 2.0E-23
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 878 1132 3.0E-23
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 397 716 3.0E-23
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 901 1132 4.0E-23
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 397 716 4.0E-23
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 397 716 8.0E-23
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 887 1132 1.0E-22
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 887 1132 6.0E-22
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 865 1125 6.0E-22
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 396 739 1.0E-21
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 369 739 1.0E-21
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 397 716 1.0E-21
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 397 716 8.0E-21
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 877 1185 4.0E-20
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 885 1128 2.0E-17
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 885 1128 6.0E-17
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 888 1227 1.0E-16
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 866 1128 1.0E-16
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 559 678 9.0E-16
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 905 1128 4.0E-15
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 871 1227 4.0E-15
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 871 1227 6.0E-15
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 885 1128 9.0E-15
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 888 1227 1.0E-14
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 871 1227 1.0E-14
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 871 1227 1.0E-14
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 871 1227 2.0E-14
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 887 1225 4.0E-14
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 412 776 7.0E-14
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 871 1227 1.0E-13
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 937 1227 6.0E-13
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 885 1128 8.0E-13
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 978 1227 9.0E-13
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 921 1227 5.0E-12
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 937 1227 1.0E-11
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 937 1227 1.0E-11
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 901 1227 2.0E-11
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 904 1100 9.0E-11
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 881 1082 2.0E-10
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 882 1125 2.0E-10
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 443 631 3.0E-10
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 978 1227 4.0E-09
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 411 648 3.0E-08
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 456 517 4.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 882 1129 6.0E-08
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 411 627 6.0E-08
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 411 643 8.0E-08
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 610 722 1.0E-07
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 404 627 2.0E-07
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 411 627 2.0E-07
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 404 627 4.0E-07
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 1 94 8.0E-07
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 411 627 8.0E-07
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 1 94 2.0E-06
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 411 627 2.0E-06
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 411 627 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|763100
MDKAFAKEEGFKLEPLERPIPVKNVDGTINASGAVTHRVAANVYYKGHKERVHFEICGLGKNKVILGMPWLQMHN
PEIDWEKGEVKMTRCPDGCGYKDKGKTKEKQEEIRKVEEPRKSTRQLMKEAREEEKKEKPDMSHKQYAGWKLISF
PKKSSWGTVLQYRCEECGTQTSEHLLSKHKCPAIEEIALDEFGMPYEGSDDEEEGPTMAKIEAYEKEQEEIRDEE
DRFERVNKAIGRFTQPKNIIEGIALGVEAAFARELARNRRANGGAEGLAQQSKEKAEGWAQSPGDVADRLNGDKA
ERLEEDNIKTATAGKAEAGQVCPKRISAQRKNRSREEEGQLETWVRGMTEEMPEEEEIRSIDSVEQMVPKRFHKF
LKVFKQKESERMPTRKPWDHAIELKEDFKPKKGKIYPLSPNEREEVQAFVKDQLRKGYIRPSKSPQTSPVFFVPK
KDGKKRMVQDYRFLNDWTIRNNYPLPLISELIDTMGSKQLFSKIDLRWGYNNIRIKEGDEWKAAFTTFMAMMNEL
FRDLVNTGKVAVFIDDILIGTDDEEEHDKVVEEVLQRLMDNDLFAKPEKCEWKRSEMGFLGCIIGRNGIKMEERK
VKDVVEWPTPKCVKDVQKFLGLANYYRRFIEKFASIAKPLHALTKKDKKWSWGDEEEEAFGALKAKFTSHPILVA
PELDKELKVESDASAYATGGELSMKCEDGKWRPVAYISKSMTETERNYDIHDREMLGIMRCLEEWRHFLEGAKHK
FEIWTDHRNLEYFAKAQQLNRRQARWALYLSRFNFELKFRPGKTMGKADPLSRRPDFEQGTKDDNKGQTLLKPEY
FAIRAMEEGHMLINAEEGEILDEIRKSEAKEDDVVKVVEEMKRAKVKSLRGDEWKLEEGLVLKEGKVYVPKDETL
RTKIIRLHHDTPIAGHGGQWKTVEMVTRNYWWPGVTKQVQKYVEGCDQCQRNKNRPTPPAGKLMPNPIPTKPWAD
VSVDFIVKLPESQGMDSILVVCDRFSKMAHFIPTTETTSALGLAKLFRDHVWKLHGLPETVISDRGPQFAADFTK
ELNKMLGIDTRLSTAFHPQTDGQTERTNQELEQYLRSFVDHRQTDWPDWLATAEFSYNNKEQSSTKETPFMVNVG
RHPRTGFDLRRQGNHPAAADFANRMKLQHEETQAALKKAQDDMRRYADRSRGEAVKYKEGDKVLLATRDLQIQGR
PTRKLTEKFIGPYTVKKIISPNAVELDLHRSIRIHPVVNVSRIVMYREDDQLGNSRRSSSGCTPSRRSFPPTQWN
*
Coding >Agabi119p4|763100
ATGGATAAGGCGTTTGCAAAGGAAGAAGGGTTCAAACTGGAACCCTTAGAGAGACCAATTCCGGTCAAAAACGTT
GATGGTACGATCAACGCATCTGGAGCAGTGACACATCGAGTTGCTGCAAATGTGTATTACAAAGGGCATAAAGAA
AGAGTCCATTTCGAAATATGTGGCCTTGGGAAAAATAAGGTCATATTAGGAATGCCCTGGTTACAAATGCACAAT
CCAGAAATTGATTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGATAAAGGA
AAAACCAAAGAAAAACAAGAGGAAATACGAAAGGTAGAAGAACCGAGGAAATCAACTAGGCAGTTGATGAAGGAA
GCACGAGAGGAAGAGAAAAAGGAAAAACCTGACATGTCGCACAAACAATATGCAGGTTGGAAATTGATTTCCTTC
CCAAAGAAATCAAGTTGGGGAACGGTGTTGCAGTACAGATGCGAAGAGTGTGGAACCCAGACTTCAGAACATTTG
CTGAGCAAGCACAAATGCCCAGCAATAGAGGAAATCGCCTTGGATGAGTTTGGGATGCCATACGAAGGAAGTGAT
GATGAAGAGGAAGGGCCAACCATGGCAAAAATAGAAGCATATGAAAAGGAACAAGAAGAGATCAGAGATGAGGAA
GACAGATTTGAACGAGTGAACAAAGCTATAGGAAGGTTCACTCAGCCAAAGAACATCATCGAAGGAATCGCATTG
GGAGTCGAAGCAGCGTTCGCTAGGGAATTGGCACGAAACAGGCGTGCTAATGGTGGAGCTGAGGGATTGGCGCAA
CAATCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGATAAGGCA
GAACGTCTAGAAGAAGACAACATCAAGACAGCCACCGCGGGCAAAGCGGAGGCTGGACAGGTATGTCCTAAACGA
ATAAGCGCCCAAAGGAAAAATAGGAGTAGGGAAGAGGAAGGACAACTGGAAACGTGGGTGAGAGGGATGACAGAA
GAGATGCCGGAAGAAGAAGAAATCCGAAGCATAGACTCAGTGGAACAAATGGTGCCAAAACGGTTCCATAAATTC
CTTAAAGTATTCAAACAGAAGGAGTCGGAAAGGATGCCTACGAGGAAACCGTGGGATCATGCTATCGAATTAAAG
GAGGATTTCAAACCCAAGAAAGGGAAAATATACCCCTTGTCACCAAACGAAAGAGAAGAGGTCCAAGCATTCGTC
AAGGATCAACTTCGAAAGGGATATATTAGGCCATCGAAATCCCCTCAAACTTCGCCAGTATTTTTTGTGCCAAAG
AAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGACTGGACAATTAGGAACAATTATCCTTTA
CCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACAATTATTTTCTAAGATAGATTTACGTTGGGGTTAT
AATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGCTATGATGAACGAACTT
TTTAGGGACTTAGTAAATACCGGAAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACGGACGATGAAGAG
GAGCACGATAAGGTGGTGGAAGAAGTATTGCAGAGGTTGATGGACAACGACCTATTCGCAAAGCCAGAAAAATGC
GAATGGAAGCGAAGCGAAATGGGATTCTTAGGGTGTATAATAGGGAGGAATGGAATCAAGATGGAGGAAAGGAAG
GTGAAAGACGTAGTAGAATGGCCAACTCCAAAATGCGTTAAAGACGTACAAAAATTCTTGGGACTAGCAAACTAT
TATCGACGGTTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAGGACAAGAAATGG
AGTTGGGGAGATGAAGAAGAGGAAGCCTTTGGTGCGTTAAAAGCAAAATTCACATCACATCCAATCCTAGTAGCA
CCAGAATTGGACAAAGAACTAAAGGTGGAATCGGACGCATCAGCCTATGCCACGGGTGGAGAATTATCGATGAAA
TGTGAAGATGGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACGGAAACTGAACGAAATTACGATATT
CACGATAGAGAGATGTTGGGGATAATGCGATGTTTAGAGGAATGGAGACACTTCCTGGAAGGGGCAAAGCATAAA
TTCGAAATTTGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAATCGACGACAAGCCAGA
TGGGCTTTGTATTTATCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGGAAAGCAGACCCA
TTGAGCAGAAGACCTGACTTCGAACAAGGAACCAAGGACGATAACAAGGGTCAAACTTTGTTAAAACCAGAATAT
TTTGCAATTCGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAAGAAGGAGAGATATTAGATGAAATCCGA
AAATCAGAAGCAAAAGAGGACGATGTAGTAAAAGTGGTGGAAGAGATGAAGCGAGCAAAGGTGAAATCGTTAAGA
GGAGACGAGTGGAAACTGGAAGAGGGGCTAGTATTGAAAGAAGGAAAAGTCTATGTGCCAAAAGATGAGACATTA
AGGACGAAAATCATTCGACTACATCACGACACTCCCATTGCCGGACATGGAGGACAATGGAAAACAGTCGAAATG
GTAACACGCAATTACTGGTGGCCTGGCGTAACTAAGCAAGTTCAGAAATACGTAGAGGGATGCGATCAATGTCAA
CGAAACAAAAATCGACCAACACCACCGGCAGGAAAATTAATGCCAAACCCCATTCCCACGAAACCCTGGGCCGAC
GTATCTGTCGACTTCATAGTAAAACTGCCAGAATCTCAGGGAATGGATTCAATCTTAGTGGTGTGCGATCGATTC
AGTAAAATGGCTCATTTTATTCCAACAACGGAAACGACATCGGCGCTAGGACTAGCCAAGTTGTTCAGGGATCAC
GTATGGAAGTTGCATGGATTACCAGAAACGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGACTTCACAAAA
GAGTTGAACAAAATGTTGGGGATCGATACCCGGTTATCTACAGCGTTCCACCCACAAACTGATGGCCAAACCGAG
CGAACCAATCAAGAATTGGAACAATACCTCCGATCATTTGTTGATCATAGACAAACTGATTGGCCAGATTGGTTA
GCAACGGCGGAGTTTTCCTATAACAATAAAGAACAATCATCAACAAAGGAAACTCCATTTATGGTTAACGTGGGA
AGACATCCAAGAACTGGTTTCGATCTTCGACGACAAGGAAATCATCCGGCAGCAGCGGACTTTGCGAACCGCATG
AAACTTCAACACGAAGAAACTCAAGCGGCCCTAAAGAAGGCACAAGACGACATGCGGAGATATGCGGATAGAAGC
AGAGGAGAAGCGGTGAAATACAAAGAAGGAGATAAAGTTCTATTGGCTACCCGGGACCTTCAAATTCAGGGACGA
CCAACTCGGAAACTTACAGAGAAGTTTATCGGGCCGTACACCGTCAAGAAGATCATTTCCCCCAATGCAGTGGAA
TTAGATCTTCACCGATCTATTCGGATCCACCCGGTGGTTAATGTCAGCCGAATAGTAATGTACCGAGAAGACGAC
CAACTCGGAAACTCACGGAGAAGTTCATCGGGCTGTACACCGTCAAGAAGATCATTTCCCCCAACGCAGTGGAAC
TAG
Transcript >Agabi119p4|763100
ATGGATAAGGCGTTTGCAAAGGAAGAAGGGTTCAAACTGGAACCCTTAGAGAGACCAATTCCGGTCAAAAACGTT
GATGGTACGATCAACGCATCTGGAGCAGTGACACATCGAGTTGCTGCAAATGTGTATTACAAAGGGCATAAAGAA
AGAGTCCATTTCGAAATATGTGGCCTTGGGAAAAATAAGGTCATATTAGGAATGCCCTGGTTACAAATGCACAAT
CCAGAAATTGATTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGATAAAGGA
AAAACCAAAGAAAAACAAGAGGAAATACGAAAGGTAGAAGAACCGAGGAAATCAACTAGGCAGTTGATGAAGGAA
GCACGAGAGGAAGAGAAAAAGGAAAAACCTGACATGTCGCACAAACAATATGCAGGTTGGAAATTGATTTCCTTC
CCAAAGAAATCAAGTTGGGGAACGGTGTTGCAGTACAGATGCGAAGAGTGTGGAACCCAGACTTCAGAACATTTG
CTGAGCAAGCACAAATGCCCAGCAATAGAGGAAATCGCCTTGGATGAGTTTGGGATGCCATACGAAGGAAGTGAT
GATGAAGAGGAAGGGCCAACCATGGCAAAAATAGAAGCATATGAAAAGGAACAAGAAGAGATCAGAGATGAGGAA
GACAGATTTGAACGAGTGAACAAAGCTATAGGAAGGTTCACTCAGCCAAAGAACATCATCGAAGGAATCGCATTG
GGAGTCGAAGCAGCGTTCGCTAGGGAATTGGCACGAAACAGGCGTGCTAATGGTGGAGCTGAGGGATTGGCGCAA
CAATCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGATAAGGCA
GAACGTCTAGAAGAAGACAACATCAAGACAGCCACCGCGGGCAAAGCGGAGGCTGGACAGGTATGTCCTAAACGA
ATAAGCGCCCAAAGGAAAAATAGGAGTAGGGAAGAGGAAGGACAACTGGAAACGTGGGTGAGAGGGATGACAGAA
GAGATGCCGGAAGAAGAAGAAATCCGAAGCATAGACTCAGTGGAACAAATGGTGCCAAAACGGTTCCATAAATTC
CTTAAAGTATTCAAACAGAAGGAGTCGGAAAGGATGCCTACGAGGAAACCGTGGGATCATGCTATCGAATTAAAG
GAGGATTTCAAACCCAAGAAAGGGAAAATATACCCCTTGTCACCAAACGAAAGAGAAGAGGTCCAAGCATTCGTC
AAGGATCAACTTCGAAAGGGATATATTAGGCCATCGAAATCCCCTCAAACTTCGCCAGTATTTTTTGTGCCAAAG
AAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGACTGGACAATTAGGAACAATTATCCTTTA
CCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACAATTATTTTCTAAGATAGATTTACGTTGGGGTTAT
AATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGCTATGATGAACGAACTT
TTTAGGGACTTAGTAAATACCGGAAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACGGACGATGAAGAG
GAGCACGATAAGGTGGTGGAAGAAGTATTGCAGAGGTTGATGGACAACGACCTATTCGCAAAGCCAGAAAAATGC
GAATGGAAGCGAAGCGAAATGGGATTCTTAGGGTGTATAATAGGGAGGAATGGAATCAAGATGGAGGAAAGGAAG
GTGAAAGACGTAGTAGAATGGCCAACTCCAAAATGCGTTAAAGACGTACAAAAATTCTTGGGACTAGCAAACTAT
TATCGACGGTTCATCGAGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAGGACAAGAAATGG
AGTTGGGGAGATGAAGAAGAGGAAGCCTTTGGTGCGTTAAAAGCAAAATTCACATCACATCCAATCCTAGTAGCA
CCAGAATTGGACAAAGAACTAAAGGTGGAATCGGACGCATCAGCCTATGCCACGGGTGGAGAATTATCGATGAAA
TGTGAAGATGGAAAGTGGAGGCCAGTGGCGTATATCTCCAAATCGATGACGGAAACTGAACGAAATTACGATATT
CACGATAGAGAGATGTTGGGGATAATGCGATGTTTAGAGGAATGGAGACACTTCCTGGAAGGGGCAAAGCATAAA
TTCGAAATTTGGACGGATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAATCGACGACAAGCCAGA
TGGGCTTTGTATTTATCTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGGAAAGCAGACCCA
TTGAGCAGAAGACCTGACTTCGAACAAGGAACCAAGGACGATAACAAGGGTCAAACTTTGTTAAAACCAGAATAT
TTTGCAATTCGAGCAATGGAAGAAGGTCATATGTTAATCAATGCGGAAGAAGGAGAGATATTAGATGAAATCCGA
AAATCAGAAGCAAAAGAGGACGATGTAGTAAAAGTGGTGGAAGAGATGAAGCGAGCAAAGGTGAAATCGTTAAGA
GGAGACGAGTGGAAACTGGAAGAGGGGCTAGTATTGAAAGAAGGAAAAGTCTATGTGCCAAAAGATGAGACATTA
AGGACGAAAATCATTCGACTACATCACGACACTCCCATTGCCGGACATGGAGGACAATGGAAAACAGTCGAAATG
GTAACACGCAATTACTGGTGGCCTGGCGTAACTAAGCAAGTTCAGAAATACGTAGAGGGATGCGATCAATGTCAA
CGAAACAAAAATCGACCAACACCACCGGCAGGAAAATTAATGCCAAACCCCATTCCCACGAAACCCTGGGCCGAC
GTATCTGTCGACTTCATAGTAAAACTGCCAGAATCTCAGGGAATGGATTCAATCTTAGTGGTGTGCGATCGATTC
AGTAAAATGGCTCATTTTATTCCAACAACGGAAACGACATCGGCGCTAGGACTAGCCAAGTTGTTCAGGGATCAC
GTATGGAAGTTGCATGGATTACCAGAAACGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGACTTCACAAAA
GAGTTGAACAAAATGTTGGGGATCGATACCCGGTTATCTACAGCGTTCCACCCACAAACTGATGGCCAAACCGAG
CGAACCAATCAAGAATTGGAACAATACCTCCGATCATTTGTTGATCATAGACAAACTGATTGGCCAGATTGGTTA
GCAACGGCGGAGTTTTCCTATAACAATAAAGAACAATCATCAACAAAGGAAACTCCATTTATGGTTAACGTGGGA
AGACATCCAAGAACTGGTTTCGATCTTCGACGACAAGGAAATCATCCGGCAGCAGCGGACTTTGCGAACCGCATG
AAACTTCAACACGAAGAAACTCAAGCGGCCCTAAAGAAGGCACAAGACGACATGCGGAGATATGCGGATAGAAGC
AGAGGAGAAGCGGTGAAATACAAAGAAGGAGATAAAGTTCTATTGGCTACCCGGGACCTTCAAATTCAGGGACGA
CCAACTCGGAAACTTACAGAGAAGTTTATCGGGCCGTACACCGTCAAGAAGATCATTTCCCCCAATGCAGTGGAA
TTAGATCTTCACCGATCTATTCGGATCCACCCGGTGGTTAATGTCAGCCGAATAGTAATGTACCGAGAAGACGAC
CAACTCGGAAACTCACGGAGAAGTTCATCGGGCTGTACACCGTCAAGAAGATCATTTCCCCCAACGCAGTGGAAC
TAG
Gene >Agabi119p4|763100
ATGGATAAGGCGTTTGCAAAGGAAGAAGGGTTCAAACTGGAACCCTTAGAGAGACCAATTCCGGTCAAAAACGTT
GATGGTACGATCAACGCATCTGGAGCAGTGACACATCGAGTTGCTGCAAATGTGTATTACAAAGGGCATAAAGAA
AGAGTCCATTTCGAAATATGTGGCCTTGGGAAAAATAAGGTCATATTAGGAATGCCCTGGTTACAAATGCACAAT
CCAGAAATTGATTGGGAGAAAGGAGAGGTAAAGATGACCAGGTGCCCAGACGGGTGTGGGTACAAAGATAAAGGA
AAAACCAAAGAAAAACAAGAGGAAATACGAAAGGTAGAAGAACCGAGGAAATCAACTAGGCAGTTGATGAAGGAA
GCACGAGAGGAAGAGAAAAAGGAAAAACCTGACATGTCGCACAAACAATATGCAGGTTGGAAATTGATTTCCTTC
CCAAAGAAATCAAGTTGGGGAACGGTGTTGCAGTACAGATGCGAAGAGTGTGGAACCCAGACTTCAGAACATTTG
CTGAGCAAGCACAAATGCCCAGCAATAGAGGAAATCGCCTTGGATGAGTTTGGGATGCCATACGAAGGAAGTGAT
GATGAAGAGGAAGGGCCAACCATGGCAAAAATAGAAGCATATGAAAAGGAACAAGAAGAGATCAGAGATGAGGAA
GACAGATTTGAACGAGTGAACAAAGCTATAGGAAGGTTCACTCAGCCAAAGAACATCATCGAAGGAATCGCATTG
GGAGTCGAAGCAGCGTTCGCTAGGGAATTGGCACGAAACAGGCGTGCTAATGGTGGAGCTGAGGGATTGGCGCAA
CAATCCAAAGAGAAAGCTGAGGGGTGGGCGCAATCACCCGGTGACGTGGCTGACCGATTAAATGGGGATAAGGCA
GAACGTCTAGAAGAAGACAACATCAAGACAGCCACCGCGGGCAAAGCGGAGGCTGGACAGGTATGTCCTAAACGA
ATAAGCGCCCAAAGGAAAAATAGGAGTAGGGAAGAGGAAGGACAACTGGAAACGTGGGTGAGAGGGATGACAGAA
GAGATGCCGGAAGAAGAAGAAATCCGAAGCATAGACTCAGTGGAACAAATGGTGCCAAAACGGTTCCATAAATTC
CTTAAAGTATTCAAACAGAAGGAGTCGGAAAGGATGCCTACGAGGAAACCGTGGGATCATGCTATCGAATTAAAG
GAGGATTTCAAACCCAAGAAAGGGAAAATATACCCCTTGTCACCAAACGAAAGAGAAGAGGTCCAAGCATTCGTC
AAGGATCAACTTCGAAAGGGATATATTAGGCCATCGAAATCCCCTCAAACTTCGCCAGTATTTTTTGTGCCAAAG
AAGGATGGAAAGAAGCGGATGGTGCAGGACTATAGGTTTTTGAACGACTGGACAATTAGGAACAATTATCCTTTA
CCTTTAATTTCTGAACTTATAGACACTATGGGTAGCAAACAATTATTTTCTAAGATAGATTTACGTTGGGGTTAT
AATAATATTAGGATAAAGGAAGGAGACGAGTGGAAGGCAGCCTTTACTACTTTCATGGGTGCCTTCGAACCAACT
GTTATGTTTTTTGGACTTACAAATTCGCCTGCTACTTTTCAGCTATGATGAACGAACTTTTTAGGGACTTAGTAA
ATACCGGAAAAGTAGCTGTATTTATTGACGATATCTTGATAGGAACGGACGATGAAGAGGAGCACGATAAGGTGG
TGGAAGAAGTATTGCAGAGGTTGATGGACAACGACCTATTCGCAAAGCCAGAAAAATGCGAATGGAAGCGAAGCG
AAATGGGATTCTTAGGGTGTATAATAGGGAGGAATGGAATCAAGATGGAGGAAAGGAAGGTGAAAGACGTAGTAG
AATGGCCAACTCCAAAATGCGTTAAAGACGTACAAAAATTCTTGGGACTAGCAAACTATTATCGACGGTTCATCG
AGAAGTTCGCTAGTATTGCAAAACCGCTACACGCATTAACCAAAAAGGACAAGAAATGGAGTTGGGGAGATGAAG
AAGAGGAAGCCTTTGGTGCGTTAAAAGCAAAATTCACATCACATCCAATCCTAGTAGCACCAGAATTGGACAAAG
AACTAAAGGTGGAATCGGACGCATCAGCCTATGCCACGGGTGGAGAATTATCGATGAAATGTGAAGATGGAAAGT
GGAGGCCAGTGGCGTATATCTCCAAATCGATGACGGAAACTGAACGAAATTACGATATTCACGATAGAGAGATGT
TGGGGATAATGCGATGTTTAGAGGAATGGAGACACTTCCTGGAAGGGGCAAAGCATAAATTCGAAATTTGGACGG
ATCATCGCAATCTAGAATACTTTGCAAAAGCCCAACAACTAAATCGACGACAAGCCAGATGGGCTTTGTATTTAT
CTAGGTTCAATTTCGAATTAAAATTCCGTCCAGGAAAGACGATGGGGAAAGCAGACCCATTGAGCAGAAGACCTG
ACTTCGAACAAGGAACCAAGGACGATAACAAGGGTCAAACTTTGTTAAAACCAGAATATTTTGCAATTCGAGCAA
TGGAAGAAGGTCATATGTTAATCAATGCGGAAGAAGGAGAGATATTAGATGAAATCCGAAAATCAGAAGCAAAAG
AGGACGATGTAGTAAAAGTGGTGGAAGAGATGAAGCGAGCAAAGGTGAAATCGTTAAGAGGAGACGAGTGGAAAC
TGGAAGAGGGGCTAGTATTGAAAGAAGGAAAAGTCTATGTGCCAAAAGATGAGACATTAAGGACGAAAATCATTC
GACTACATCACGACACTCCCATTGCCGGACATGGAGGACAATGGAAAACAGTCGAAATGGTAACACGCAATTACT
GGTGGCCTGGCGTAACTAAGCAAGTTCAGAAATACGTAGAGGGATGCGATCAATGTCAACGAAACAAAAATCGAC
CAACACCACCGGCAGGAAAATTAATGCCAAACCCCATTCCCACGAAACCCTGGGCCGACGTATCTGTCGACTTCA
TAGTAAAACTGCCAGAATCTCAGGGAATGGATTCAATCTTAGTGGTGTGCGATCGATTCAGTAAAATGGCTCATT
TTATTCCAACAACGGAAACGACATCGGCGCTAGGACTAGCCAAGTTGTTCAGGGATCACGTATGGAAGTTGCATG
GATTACCAGAAACGGTGATCTCAGATAGGGGACCGCAGTTTGCTGCAGACTTCACAAAAGAGTTGAACAAAATGT
TGGGGATCGATACCCGGTTATCTACAGCGTTCCACCCACAAACTGATGGCCAAACCGAGCGAACCAATCAAGAAT
TGGAACAATACCTCCGATCATTTGTTGATCATAGACAAACTGATTGGCCAGATTGGTTAGCAACGGCGGAGTTTT
CCTATAACAATAAAGAACAATCATCAACAAAGGAAACTCCATTTATGGTTAACGTGGGAAGACATCCAAGAACTG
GTTTCGATCTTCGACGACAAGGAAATCATCCGGCAGCAGCGGACTTTGCGAACCGCATGAAACTTCAACACGAAG
AAACTCAAGCGGCCCTAAAGAAGGCACAAGACGACATGCGGAGATATGCGGATAGAAGCAGAGGAGAAGCGGTGA
AATACAAAGAAGGAGATAAAGTTCTATTGGCTACCCGGGACCTTCAAATTCAGGGACGACCAACTCGGAAACTTA
CAGAGAAGTTTATCGGGCCGTACACCGTCAAGAAGATCATTTCCCCCAATGCAGTGGAATTAGATCTTCACCGAT
CTATTCGGATCCACCCGGTGGTTAATGTCAGCCGAATAGTAATGTACCGAGAAGACGACCAACTCGGAAACTCAC
GGAGAAGTTCATCGGGCTGTACACCGTCAAGAAGATCATTTCCCCCAACGCAGTGGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail