Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|761650
Gene name
Locationscaffold_11:1679422..1682246
Strand-
Gene length (bp)2824
Transcript length (bp)2064
Coding sequence length (bp)2064
Protein length (aa) 688

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03746 LamB_YcsF LamB/YcsF family 3.0E-79 440 678
PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88 7.1E-17 97 280

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38096|LAMB_EMENI Lactam utilization protein lamB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamB PE=2 SV=2 437 682 2.0E-60
sp|Q8CSB6|Y1287_STAES UPF0271 protein SE_1287 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1287 PE=3 SV=1 435 680 5.0E-53
sp|Q5HNU6|Y1168_STAEQ UPF0271 protein SERP1168 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1168 PE=3 SV=1 435 680 5.0E-53
sp|A6U274|Y1696_STAA2 UPF0271 protein SaurJH1_1696 OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_1696 PE=3 SV=1 436 686 7.0E-49
sp|A5ITD0|Y1662_STAA9 UPF0271 protein SaurJH9_1662 OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_1662 PE=3 SV=1 436 686 7.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38096|LAMB_EMENI Lactam utilization protein lamB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamB PE=2 SV=2 437 682 2.0E-60
sp|Q8CSB6|Y1287_STAES UPF0271 protein SE_1287 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1287 PE=3 SV=1 435 680 5.0E-53
sp|Q5HNU6|Y1168_STAEQ UPF0271 protein SERP1168 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1168 PE=3 SV=1 435 680 5.0E-53
sp|A6U274|Y1696_STAA2 UPF0271 protein SaurJH1_1696 OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_1696 PE=3 SV=1 436 686 7.0E-49
sp|A5ITD0|Y1662_STAA9 UPF0271 protein SaurJH9_1662 OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_1662 PE=3 SV=1 436 686 7.0E-49
sp|P67622|Y1605_STAAM UPF0271 protein SAV1605 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1605 PE=3 SV=1 436 686 7.0E-49
sp|A7X313|Y1592_STAA1 UPF0271 protein SAHV_1592 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=SAHV_1592 PE=3 SV=1 436 686 7.0E-49
sp|P67623|Y1433_STAAN UPF0271 protein SA1433 OS=Staphylococcus aureus (strain N315) GN=SA1433 PE=3 SV=1 436 686 7.0E-49
sp|Q8U1D7|Y1272_PYRFU UPF0271 protein PF1272 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1272 PE=3 SV=1 436 685 1.0E-48
sp|Q2FXX2|Y1708_STAA8 UPF0271 protein SAOUHSC_01708 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01708 PE=3 SV=1 436 686 1.0E-48
sp|Q5HFF7|Y1660_STAAC UPF0271 protein SACOL1660 OS=Staphylococcus aureus (strain COL) GN=SACOL1660 PE=3 SV=1 436 686 1.0E-48
sp|A8Z4E3|Y1605_STAAT UPF0271 protein USA300HOU_1605 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_1605 PE=3 SV=1 436 686 1.0E-48
sp|Q2FGC1|Y1562_STAA3 UPF0271 protein SAUSA300_1562 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1562 PE=3 SV=1 436 686 1.0E-48
sp|A6QHE6|Y1506_STAAE UPF0271 protein NWMN_1506 OS=Staphylococcus aureus (strain Newman) GN=NWMN_1506 PE=3 SV=1 436 686 1.0E-48
sp|Q2YT73|Y1476_STAAB UPF0271 protein SAB1476c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1476c PE=3 SV=1 436 686 1.0E-48
sp|Q8NW95|Y1555_STAAW UPF0271 protein MW1555 OS=Staphylococcus aureus (strain MW2) GN=MW1555 PE=3 SV=1 436 686 1.0E-48
sp|Q6G8W4|Y1541_STAAS UPF0271 protein SAS1541 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1541 PE=3 SV=1 436 686 1.0E-48
sp|B2A1I6|Y1143_NATTJ UPF0271 protein Nther_1143 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=Nther_1143 PE=3 SV=1 440 686 2.0E-48
sp|Q6GG98|Y1684_STAAR UPF0271 protein SAR1684 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1684 PE=3 SV=1 436 686 3.0E-48
sp|Q49Y42|Y1157_STAS1 UPF0271 protein SSP1157 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1157 PE=3 SV=1 436 685 3.0E-48
sp|Q4L6V2|Y1314_STAHJ UPF0271 protein SH1314 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1314 PE=3 SV=1 436 680 9.0E-48
sp|A8FNK1|Y1440_CAMJ8 UPF0271 protein C8J_1440 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=C8J_1440 PE=3 SV=1 436 685 1.0E-47
sp|Q9PMC8|Y1541_CAMJE UPF0271 protein Cj1541 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj1541 PE=3 SV=1 436 685 1.0E-47
sp|A1W1E0|Y1526_CAMJJ UPF0271 protein CJJ81176_1526 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=CJJ81176_1526 PE=3 SV=1 436 685 1.0E-47
sp|B6YWS6|Y1051_THEON UPF0271 protein TON_1051 OS=Thermococcus onnurineus (strain NA1) GN=TON_1051 PE=3 SV=1 436 685 1.0E-47
sp|Q5JG28|Y336_THEKO UPF0271 protein TK0336 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0336 PE=3 SV=1 436 685 2.0E-47
sp|B5Y6A9|Y1531_COPPD UPF0271 protein COPRO5265_1531 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=COPRO5265_1531 PE=3 SV=1 435 685 4.0E-47
sp|A7H5Q5|Y1899_CAMJD UPF0271 protein JJD26997_1899 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=JJD26997_1899 PE=3 SV=1 436 685 5.0E-47
sp|O58714|Y986_PYRHO UPF0271 protein PH0986 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0986 PE=1 SV=1 436 685 7.0E-47
sp|Q9V005|Y993_PYRAB UPF0271 protein PYRAB09930 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB09930 PE=3 SV=1 436 685 1.0E-46
sp|C6A2E8|Y730_THESM UPF0271 protein TSIB_0730 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=TSIB_0730 PE=3 SV=1 436 685 1.0E-46
sp|Q5HSP5|Y1712_CAMJR UPF0271 protein CJE1712 OS=Campylobacter jejuni (strain RM1221) GN=CJE1712 PE=3 SV=1 436 685 2.0E-46
sp|Q65NB0|Y498_BACLD UPF0271 protein BLi00498/BL02806 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi00498 PE=3 SV=1 440 676 8.0E-46
sp|A6LX30|Y2759_CLOB8 UPF0271 protein Cbei_2759 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_2759 PE=3 SV=1 437 685 9.0E-46
sp|A5N106|Y2790_CLOK5 UPF0271 protein CKL_2790 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=CKL_2790 PE=3 SV=1 437 676 2.0E-45
sp|B9E4V7|Y2481_CLOK1 UPF0271 protein CKR_2481 OS=Clostridium kluyveri (strain NBRC 12016) GN=CKR_2481 PE=3 SV=1 437 676 2.0E-45
sp|B9DKJ7|Y2038_STACT UPF0271 protein Sca_2038 OS=Staphylococcus carnosus (strain TM300) GN=Sca_2038 PE=3 SV=1 436 685 2.0E-45
sp|Q639M2|Y2808_BACCZ UPF0271 protein BCE33L2808 OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L2808 PE=3 SV=1 440 685 3.0E-45
sp|B7HVU6|Y3118_BACC7 UPF0271 protein BCAH187_A3118 OS=Bacillus cereus (strain AH187) GN=BCAH187_A3118 PE=3 SV=1 440 685 3.0E-45
sp|B9J590|Y2904_BACCQ UPF0271 protein BCQ_2904 OS=Bacillus cereus (strain Q1) GN=BCQ_2904 PE=3 SV=1 440 685 3.0E-45
sp|B7JE03|Y3100_BACC0 UPF0271 protein BCAH820_3100 OS=Bacillus cereus (strain AH820) GN=BCAH820_3100 PE=3 SV=1 440 685 4.0E-45
sp|A7GQB8|Y2060_BACCN UPF0271 protein Bcer98_2060 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_2060 PE=3 SV=1 440 676 7.0E-45
sp|Q81BT0|Y3066_BACCR UPF0271 protein BC_3066 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_3066 PE=3 SV=1 440 685 2.0E-44
sp|Q87UC7|Y5378_PSESM UPF0271 protein PSPTO_5378 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_5378 PE=3 SV=1 440 686 3.0E-44
sp|C1F030|Y3156_BACC3 UPF0271 protein BCA_3156 OS=Bacillus cereus (strain 03BB102) GN=BCA_3156 PE=3 SV=1 440 685 3.0E-44
sp|A7Z1F1|Y428_BACMF UPF0271 protein RBAM_004280 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_004280 PE=3 SV=1 440 676 3.0E-44
sp|C3P0S0|Y3146_BACAA UPF0271 protein BAA_3146 OS=Bacillus anthracis (strain A0248) GN=BAA_3146 PE=3 SV=1 440 685 4.0E-44
sp|Q81NT0|Y3095_BACAN UPF0271 protein BA_3095/GBAA_3095/BAS2880 OS=Bacillus anthracis GN=BA_3095 PE=3 SV=1 440 685 4.0E-44
sp|B7H8H6|Y3086_BACC4 UPF0271 protein BCB4264_A3086 OS=Bacillus cereus (strain B4264) GN=BCB4264_A3086 PE=3 SV=1 440 685 6.0E-44
sp|A9VKB0|Y2872_BACWK UPF0271 protein BcerKBAB4_2872 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_2872 PE=3 SV=1 440 685 7.0E-44
sp|B2GE66|Y1612_LACF3 UPF0271 protein LAF_1612 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1612 PE=3 SV=1 440 686 1.0E-43
sp|Q6HH05|Y2847_BACHK UPF0271 protein BT9727_2847 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2847 PE=3 SV=1 440 685 1.0E-43
sp|Q735N3|Y3119_BACC1 UPF0271 protein BCE_3119 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_3119 PE=3 SV=1 440 685 2.0E-43
sp|B9E7M7|Y1488_MACCJ UPF0271 protein MCCL_1488 OS=Macrococcus caseolyticus (strain JCSC5402) GN=MCCL_1488 PE=3 SV=1 440 686 3.0E-43
sp|C3LDU8|Y1513_BACAC UPF0271 protein BAMEG_1513 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=BAMEG_1513 PE=3 SV=1 440 685 5.0E-43
sp|P42963|YCSF_BACSU UPF0271 protein YcsF OS=Bacillus subtilis (strain 168) GN=ycsF PE=3 SV=4 440 676 2.0E-42
sp|Q53WG6|Y2695_THET8 UPF0271 protein TTHB195 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHB195 PE=1 SV=1 436 686 2.0E-42
sp|Q1QYS2|Y1029_CHRSD UPF0271 protein Csal_1029 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_1029 PE=3 SV=1 440 679 4.0E-42
sp|Q746B8|Y2237_THET2 UPF0271 protein TT_P0137 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_P0137 PE=3 SV=1 436 686 7.0E-42
sp|Q5LMA4|Y3659_RUEPO UPF0271 protein SPO3659 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO3659 PE=3 SV=1 437 685 8.0E-42
sp|Q87HS9|Y4877_VIBPA UPF0271 protein VPA0877 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0877 PE=3 SV=1 437 676 1.0E-41
sp|Q8D788|Y4273_VIBVU UPF0271 protein VV2_0273 OS=Vibrio vulnificus (strain CMCP6) GN=VV2_0273 PE=3 SV=2 437 678 1.0E-41
sp|Q18BQ3|Y1384_PEPD6 UPF0271 protein CD630_13840 OS=Peptoclostridium difficile (strain 630) GN=CD630_13840 PE=3 SV=1 437 676 2.0E-41
sp|B3QJF8|Y2956_RHOPT UPF0271 protein Rpal_2956 OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_2956 PE=3 SV=1 436 685 2.0E-41
sp|Q88IS9|Y2920_PSEPK UPF0271 protein PP_2920 OS=Pseudomonas putida (strain KT2440) GN=PP_2920 PE=3 SV=1 441 686 2.0E-41
sp|Q6CYM1|Y4486_PECAS UPF0271 protein ECA4486 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ECA4486 PE=3 SV=1 436 679 2.0E-41
sp|C4LFU8|Y1858_TOLAT UPF0271 protein Tola_1858 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=Tola_1858 PE=3 SV=1 440 686 3.0E-41
sp|Q60BJ2|Y476_METCA UPF0271 protein MCA0476 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=MCA0476 PE=3 SV=1 432 675 3.0E-41
sp|Q6N6D6|Y2681_RHOPA UPF0271 protein RPA2681 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA2681 PE=3 SV=1 436 685 4.0E-41
sp|A5EZN1|Y716_VIBC3 UPF0271 protein VC0395_0716/VC395_A0539 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=VC0395_0716 PE=3 SV=1 440 680 6.0E-41
sp|Q9KLG8|Y3576_VIBCH UPF0271 protein VC_A0776 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_A0776 PE=3 SV=1 440 680 6.0E-41
sp|C3LW40|Y3535_VIBCM UPF0271 protein VCM66_A0735 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=VCM66_A0735 PE=3 SV=1 440 680 6.0E-41
sp|A7N8I1|Y5795_VIBCB UPF0271 protein VIBHAR_05795 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=VIBHAR_05795 PE=3 SV=1 437 676 1.0E-40
sp|A8FA07|Y379_BACP2 UPF0271 protein BPUM_0379 OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_0379 PE=3 SV=1 440 686 1.0E-40
sp|Q7ME92|Y4778_VIBVY UPF0271 protein VVA0778 OS=Vibrio vulnificus (strain YJ016) GN=VVA0778 PE=3 SV=2 437 678 1.0E-40
sp|Q5WBF8|Y3770_BACSK UPF0271 protein ABC3770 OS=Bacillus clausii (strain KSM-K16) GN=ABC3770 PE=3 SV=1 440 686 1.0E-40
sp|Q881F7|Y2936_PSESM UPF0271 protein PSPTO_2936 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2936 PE=3 SV=1 436 686 1.0E-40
sp|Q8XRC2|Y4436_RALSO UPF0271 protein RSp0936 OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0936 PE=3 SV=1 436 679 2.0E-40
sp|Q881H6|Y2917_PSESM UPF0271 protein PSPTO_2917 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2917 PE=3 SV=1 436 682 3.0E-40
sp|Q7WF01|Y4479_BORBR UPF0271 protein BB4479 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB4479 PE=3 SV=1 440 686 4.0E-40
sp|Q7W3M5|Y4006_BORPA UPF0271 protein BPP4006 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP4006 PE=3 SV=1 440 686 4.0E-40
sp|B2AG42|Y068_CUPTR UPF0271 protein RALTA_A0068 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A0068 PE=3 SV=1 436 686 5.0E-40
sp|A3M451|Y1267_ACIBT UPF0271 protein A1S_1267 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=A1S_1267 PE=3 SV=2 440 686 5.0E-40
sp|Q6F9H7|Y2520_ACIAD UPF0271 protein ACIAD2520 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD2520 PE=3 SV=1 436 686 5.0E-40
sp|Q8U920|Y3910_AGRFC UPF0271 protein Atu3910 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu3910 PE=3 SV=1 440 686 5.0E-40
sp|Q477G2|Y089_CUPPJ UPF0271 protein Reut_A0089 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A0089 PE=3 SV=1 436 686 5.0E-40
sp|O30444|Y150_BORPE UPF0271 protein BP0150 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=BP0150 PE=3 SV=1 440 686 8.0E-40
sp|B2HXI0|Y1267_ACIBC UPF0271 protein ACICU_01267 OS=Acinetobacter baumannii (strain ACICU) GN=ACICU_01267 PE=3 SV=1 440 686 8.0E-40
sp|A1TSY0|Y3513_ACIAC UPF0271 protein Aave_3513 OS=Acidovorax citrulli (strain AAC00-1) GN=Aave_3513 PE=3 SV=1 440 686 1.0E-39
sp|Q7MZI3|Y4304_PHOLL UPF0271 protein plu4304 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu4304 PE=3 SV=2 440 686 1.0E-39
sp|A0LNR3|Y3392_SYNFM UPF0271 protein Sfum_3392 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=Sfum_3392 PE=3 SV=1 436 679 2.0E-39
sp|Q136X6|Y2634_RHOPS UPF0271 protein RPD_2634 OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_2634 PE=3 SV=1 436 685 2.0E-39
sp|B0VAY5|Y2441_ACIBY UPF0271 protein ABAYE2441 OS=Acinetobacter baumannii (strain AYE) GN=ABAYE2441 PE=3 SV=1 440 686 2.0E-39
sp|B7H4L9|Y2265_ACIB3 UPF0271 protein ABBFA_002265 OS=Acinetobacter baumannii (strain AB307-0294) GN=ABBFA_002265 PE=3 SV=1 440 686 2.0E-39
sp|B7IBY8|Y1453_ACIB5 UPF0271 protein AB57_1453 OS=Acinetobacter baumannii (strain AB0057) GN=AB57_1453 PE=3 SV=1 440 686 2.0E-39
sp|Q0KFE3|Y126_CUPNH UPF0271 protein H16_A0126 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A0126 PE=3 SV=1 436 686 3.0E-39
sp|A4IN19|Y1353_GEOTN UPF0271 protein GTNG_1353 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_1353 PE=3 SV=1 440 686 4.0E-39
sp|C0ZCX3|Y2655_BREBN UPF0271 protein BBR47_26550 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=BBR47_26550 PE=3 SV=1 440 685 8.0E-39
sp|Q2IW74|Y2834_RHOP2 UPF0271 protein RPB_2834 OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_2834 PE=3 SV=1 436 685 8.0E-39
sp|B9LC61|Y1437_CHLSY UPF0271 protein Chy400_1437 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=Chy400_1437 PE=3 SV=1 436 676 9.0E-39
sp|A9W9Q7|Y1315_CHLAA UPF0271 protein Caur_1315 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_1315 PE=3 SV=1 436 676 9.0E-39
sp|Q63NV1|Y4198_BURPS UPF0271 protein BPSS0198 OS=Burkholderia pseudomallei (strain K96243) GN=BPSS0198 PE=3 SV=1 434 685 2.0E-38
sp|Q8EN13|Y2677_OCEIH UPF0271 protein OB2677 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2677 PE=3 SV=1 437 686 2.0E-38
sp|Q89P49|Y3634_BRADU UPF0271 protein blr3634 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr3634 PE=3 SV=1 436 680 2.0E-38
sp|Q1QLQ7|Y2042_NITHX UPF0271 protein Nham_2042 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_2042 PE=3 SV=1 440 685 3.0E-38
sp|Q7WEA9|Y4725_BORBR UPF0271 protein BB4725 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB4725 PE=3 SV=1 440 686 3.0E-38
sp|A1K1F6|Y043_AZOSB UPF0271 protein azo0043 OS=Azoarcus sp. (strain BH72) GN=azo0043 PE=3 SV=1 436 672 9.0E-38
sp|Q88E89|Y4577_PSEPK UPF0271 protein PP_4577 OS=Pseudomonas putida (strain KT2440) GN=PP_4577 PE=3 SV=1 437 679 1.0E-37
sp|Q07M58|Y3039_RHOP5 UPF0271 protein RPE_3039 OS=Rhodopseudomonas palustris (strain BisA53) GN=RPE_3039 PE=3 SV=1 440 685 1.0E-37
sp|Q8RG75|Y439_FUSNN UPF0271 protein FN0439 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN0439 PE=3 SV=1 440 676 4.0E-37
sp|Q9KBV3|Y1821_BACHD UPF0271 protein BH1821 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH1821 PE=3 SV=1 437 668 5.0E-37
sp|A1JR39|Y2953_YERE8 UPF0271 protein YE2953 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=YE2953 PE=3 SV=1 436 685 6.0E-37
sp|Q8U822|Y4277_AGRFC UPF0271 protein Atu4277 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu4277 PE=3 SV=2 436 685 6.0E-37
sp|Q8R9J9|Y1608_CALS4 UPF0271 protein TTE1608 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1608 PE=3 SV=1 437 685 7.0E-37
sp|Q1LSC6|Y064_CUPMC UPF0271 protein Rmet_0064 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0064 PE=3 SV=1 436 686 2.0E-36
sp|B8GBN6|Y1958_CHLAD UPF0271 protein Cagg_1958 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=Cagg_1958 PE=3 SV=1 436 686 2.0E-36
sp|Q6AB26|Y282_PROAC UPF0271 protein PPA0282 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0282 PE=3 SV=1 440 686 2.0E-36
sp|Q9RL45|Y441_STRCO UPF0271 protein SCO0441 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0441 PE=3 SV=1 440 685 5.0E-36
sp|Q9I626|Y492_PSEAE UPF0271 protein PA0492 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0492 PE=3 SV=1 440 670 8.0E-36
sp|Q8XXE5|Y2169_RALSO UPF0271 protein RSc2169 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2169 PE=3 SV=1 440 686 9.0E-36
sp|Q214L4|Y2622_RHOPB UPF0271 protein RPC_2622 OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_2622 PE=3 SV=1 440 685 1.0E-35
sp|Q3KGF8|Y1405_PSEPF UPF0271 protein Pfl01_1405 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_1405 PE=3 SV=1 432 682 3.0E-35
sp|B2GHI3|Y2112_KOCRD UPF0271 protein KRH_21120 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=KRH_21120 PE=3 SV=1 440 686 8.0E-35
sp|Q827I5|Y6939_STRAW UPF0271 protein SAV_6939 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_6939 PE=3 SV=1 440 685 9.0E-35
sp|B0TAN9|Y1066_HELMI UPF0271 protein Helmi_10660 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=Helmi_10660 PE=3 SV=1 436 666 1.0E-34
sp|A6TSF8|Y2977_ALKMQ UPF0271 protein Amet_2977 OS=Alkaliphilus metalliredigens (strain QYMF) GN=Amet_2977 PE=3 SV=1 440 685 1.0E-34
sp|A9R3Y2|Y3591_YERPG UPF0271 protein YpAngola_A3591 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=YpAngola_A3591 PE=3 SV=1 436 685 1.0E-34
sp|B2KA67|Y3021_YERPB UPF0271 protein YPTS_3021 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_3021 PE=3 SV=1 436 685 1.0E-34
sp|Q667T3|Y2908_YERPS UPF0271 protein YPTB2908 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB2908 PE=3 SV=2 436 685 1.0E-34
sp|Q8ZD89|Y2700_YERPE UPF0271 protein YPO2700/y1276/YP_2504 OS=Yersinia pestis GN=YPO2700 PE=3 SV=1 436 685 1.0E-34
sp|Q1C575|Y2432_YERPA UPF0271 protein YPA_2432 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=YPA_2432 PE=3 SV=1 436 685 1.0E-34
sp|A4TKZ6|Y1571_YERPP UPF0271 protein YPDSF_1571 OS=Yersinia pestis (strain Pestoides F) GN=YPDSF_1571 PE=3 SV=1 436 685 1.0E-34
sp|Q1CKG2|Y1188_YERPN UPF0271 protein YPN_1188 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=YPN_1188 PE=3 SV=1 436 685 1.0E-34
sp|B1JRA7|Y1169_YERPY UPF0271 protein YPK_1169 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=YPK_1169 PE=3 SV=1 436 685 1.0E-34
sp|A7FFS0|Y1117_YERP3 UPF0271 protein YpsIP31758_1117 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=YpsIP31758_1117 PE=3 SV=1 436 685 1.0E-34
sp|B1VKZ4|Y3193_STRGG UPF0271 protein SGR_3193 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_3193 PE=3 SV=1 440 686 2.0E-34
sp|Q4JX93|Y407_CORJK UPF0271 protein jk0407 OS=Corynebacterium jeikeium (strain K411) GN=jk0407 PE=3 SV=1 436 685 2.0E-34
sp|B2U8X6|Y2372_RALPJ UPF0271 protein Rpic_2372 OS=Ralstonia pickettii (strain 12J) GN=Rpic_2372 PE=3 SV=1 440 686 3.0E-34
sp|Q67LD9|Y2522_SYMTH UPF0271 protein STH2522 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH2522 PE=3 SV=1 437 685 3.0E-34
sp|B2JIN1|Y2905_BURP8 UPF0271 protein Bphy_2905 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=Bphy_2905 PE=3 SV=1 436 685 3.0E-34
sp|Q3SSH7|Y1503_NITWN UPF0271 protein Nwi_1503 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_1503 PE=3 SV=1 440 685 4.0E-34
sp|Q5KZU9|Y1502_GEOKA UPF0271 protein GK1502 OS=Geobacillus kaustophilus (strain HTA426) GN=GK1502 PE=3 SV=1 440 686 5.0E-34
sp|Q3A9E0|Y2450_CARHZ UPF0271 protein CHY_2450 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=CHY_2450 PE=3 SV=1 440 686 5.0E-34
sp|A5UBF2|Y3400_HAEIE UPF0271 protein CGSHiEE_03400 OS=Haemophilus influenzae (strain PittEE) GN=CGSHiEE_03400 PE=3 SV=1 437 680 6.0E-34
sp|Q4QJL8|Y2036_HAEI8 UPF0271 protein NTHI2036 OS=Haemophilus influenzae (strain 86-028NP) GN=NTHI2036 PE=3 SV=1 437 680 6.0E-34
sp|P45347|Y1729_HAEIN UPF0271 protein HI_1729 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1729 PE=1 SV=2 437 680 6.0E-34
sp|Q0I195|Y027_HAES1 UPF0271 protein HS_0027 OS=Haemophilus somnus (strain 129Pt) GN=HS_0027 PE=3 SV=1 440 683 6.0E-34
sp|A5UFG0|Y2380_HAEIG UPF0271 protein CGSHiGG_02380 OS=Haemophilus influenzae (strain PittGG) GN=CGSHiGG_02380 PE=3 SV=1 437 680 7.0E-34
sp|B0UWY1|Y1920_HISS2 UPF0271 protein HSM_1920 OS=Histophilus somni (strain 2336) GN=HSM_1920 PE=3 SV=1 440 683 9.0E-34
sp|Q7NT87|Y3173_CHRVO UPF0271 protein CV_3173 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=CV_3173 PE=3 SV=1 436 679 1.0E-33
sp|A4JIL2|Y3124_BURVG UPF0271 protein Bcep1808_3124 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=Bcep1808_3124 PE=3 SV=1 436 685 1.0E-33
sp|Q9CCW2|Y333_MYCLE UPF0271 protein ML0333 OS=Mycobacterium leprae (strain TN) GN=ML0333 PE=3 SV=1 440 686 2.0E-33
sp|B8ZUB2|Y333_MYCLB UPF0271 protein MLBr00333 OS=Mycobacterium leprae (strain Br4923) GN=MLBr00333 PE=3 SV=1 440 686 2.0E-33
sp|Q5YMT5|Y5654_NOCFA UPF0271 protein NFA_56540 OS=Nocardia farcinica (strain IFM 10152) GN=NFA_56540 PE=3 SV=1 440 675 2.0E-33
sp|Q9I203|Y2112_PSEAE UPF0271 protein PA2112 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2112 PE=3 SV=1 440 679 2.0E-33
sp|Q89LH6|Y4568_BRADU UPF0271 protein blr4568 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr4568 PE=3 SV=1 440 685 3.0E-33
sp|A9M3F3|Y1916_NEIM0 UPF0271 protein NMCC_1916 OS=Neisseria meningitidis serogroup C (strain 053442) GN=NMCC_1916 PE=3 SV=1 440 676 4.0E-33
sp|Q9HVR0|Y4511_PSEAE UPF0271 protein PA4511 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA4511 PE=1 SV=1 437 679 4.0E-33
sp|Q2T213|Y228_BURTA UPF0271 protein BTH_I0228 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=BTH_I0228 PE=3 SV=1 436 679 5.0E-33
sp|Q63YD1|Y257_BURPS UPF0271 protein BPSL0257 OS=Burkholderia pseudomallei (strain K96243) GN=BPSL0257 PE=3 SV=1 436 679 6.0E-33
sp|B5XZE1|Y3846_KLEP3 UPF0271 protein KPK_3846 OS=Klebsiella pneumoniae (strain 342) GN=KPK_3846 PE=3 SV=1 440 675 6.0E-33
sp|Q13T51|Y4200_BURXL UPF0271 protein Bxeno_A4200 OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A4200 PE=3 SV=1 436 685 9.0E-33
sp|P0A0Z2|Y228_NEIMB UPF0271 protein rni3 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rni3 PE=3 SV=1 440 676 9.0E-33
sp|A1KRR2|Y227_NEIMF UPF0271 protein NMC0227 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=NMC0227 PE=3 SV=1 440 676 9.0E-33
sp|P0A0Z1|Y030_NEIMA UPF0271 protein rni3 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rni3 PE=3 SV=1 440 676 9.0E-33
sp|Q4KGJ3|Y1513_PSEF5 UPF0271 protein PFL_1513 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_1513 PE=3 SV=1 440 682 1.0E-32
sp|B2T6V9|Y3743_BURPP UPF0271 protein Bphyt_3743 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_3743 PE=3 SV=1 436 685 1.0E-32
sp|A9ABQ1|Y198_BURM1 UPF0271 protein Bmul_3034/BMULJ_00198 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=Bmul_3034 PE=3 SV=1 436 685 2.0E-32
sp|A3MRJ9|Y5870_BURM7 UPF0271 protein BMA10247_3370 OS=Burkholderia mallei (strain NCTC 10247) GN=BMA10247_3370 PE=3 SV=1 436 679 3.0E-32
sp|A1V7S0|Y4778_BURMS UPF0271 protein BMASAVP1_A2978 OS=Burkholderia mallei (strain SAVP1) GN=BMASAVP1_A2978 PE=3 SV=1 436 679 3.0E-32
sp|A2S808|Y4413_BURM9 UPF0271 protein BMA10229_A2113 OS=Burkholderia mallei (strain NCTC 10229) GN=BMA10229_A2113 PE=3 SV=1 436 679 3.0E-32
sp|Q62EU9|Y3309_BURMA UPF0271 protein BMA3309 OS=Burkholderia mallei (strain ATCC 23344) GN=BMA3309 PE=3 SV=1 436 679 3.0E-32
sp|A8GB71|Y1257_SERP5 UPF0271 protein Spro_1257 OS=Serratia proteamaculans (strain 568) GN=Spro_1257 PE=3 SV=1 440 676 3.0E-32
sp|Q8FQQ3|Y1066_COREF UPF0271 protein CE1066 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE1066 PE=3 SV=1 432 686 3.0E-32
sp|A0QAC2|Y580_MYCA1 UPF0271 protein MAV_0580 OS=Mycobacterium avium (strain 104) GN=MAV_0580 PE=3 SV=1 440 686 4.0E-32
sp|B1K0B1|Y3058_BURCC UPF0271 protein Bcenmc03_3058 OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_3058 PE=3 SV=1 436 679 4.0E-32
sp|Q0BB33|Y3084_BURCM UPF0271 protein Bamb_3084 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_3084 PE=3 SV=1 436 675 6.0E-32
sp|B1YPC1|Y2950_BURA4 UPF0271 protein BamMC406_2950 OS=Burkholderia ambifaria (strain MC40-6) GN=BamMC406_2950 PE=3 SV=1 436 675 6.0E-32
sp|C6DCC6|Y1228_PECCP UPF0271 protein PC1_1228 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=PC1_1228 PE=3 SV=1 440 685 6.0E-32
sp|Q5FUE6|Y211_GLUOX UPF0271 protein GOX0211 OS=Gluconobacter oxydans (strain 621H) GN=GOX0211 PE=3 SV=1 440 686 8.0E-32
sp|Q39C36|Y6386_BURL3 UPF0271 protein Bcep18194_A6386 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_A6386 PE=3 SV=1 436 679 1.0E-31
sp|A8HRP6|Y4074_AZOC5 UPF0271 protein AZC_4074 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_4074 PE=3 SV=1 440 685 1.0E-31
sp|Q743V5|Y486_MYCPA UPF0271 protein MAP_0486c OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_0486c PE=3 SV=1 440 686 1.0E-31
sp|B7N9V2|YBGL_ECOLU UPF0271 protein YbgL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ybgL PE=3 SV=1 436 683 3.0E-31
sp|A9MJN1|YBGL_SALAR UPF0271 protein YbgL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ybgL PE=3 SV=1 436 683 3.0E-31
sp|A6T6E6|Y706_KLEP7 UPF0271 protein KPN78578_07060 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=KPN78578_07060 PE=3 SV=1 436 685 1.0E-30
sp|Q220D5|Y870_RHOFT UPF0271 protein Rfer_0870 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_0870 PE=3 SV=1 436 686 1.0E-30
sp|B2VBP4|Y2314_ERWT9 UPF0271 protein ETA_23140 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ETA_23140 PE=3 SV=1 436 676 2.0E-30
sp|B1LLF0|YBGL_ECOSM UPF0271 protein YbgL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ybgL PE=3 SV=1 436 683 4.0E-30
sp|A0JR24|Y093_ARTS2 UPF0271 protein Arth_0093 OS=Arthrobacter sp. (strain FB24) GN=Arth_0093 PE=3 SV=1 440 666 4.0E-30
sp|Q8NRP4|Y1004_CORGL UPF0271 protein Cgl1004/cg1141 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl1004 PE=3 SV=1 440 678 7.0E-30
sp|A4QCX4|Y1095_CORGB UPF0271 protein cgR_1095 OS=Corynebacterium glutamicum (strain R) GN=cgR_1095 PE=3 SV=1 440 678 7.0E-30
sp|A8AJA9|Y2455_CITK8 UPF0271 protein CKO_02455 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=CKO_02455 PE=3 SV=1 440 685 8.0E-30
sp|A4T5K5|Y1451_MYCGI UPF0271 protein Mflv_1451 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_1451 PE=3 SV=1 440 685 1.0E-29
sp|Q3Z490|YBGL_SHISS UPF0271 protein YbgL OS=Shigella sonnei (strain Ss046) GN=ybgL PE=3 SV=1 436 683 1.0E-29
sp|P75746|YBGL_ECOLI UPF0271 protein YbgL OS=Escherichia coli (strain K12) GN=ybgL PE=1 SV=1 436 683 1.0E-29
sp|B1X6P4|YBGL_ECODH UPF0271 protein YbgL OS=Escherichia coli (strain K12 / DH10B) GN=ybgL PE=3 SV=1 436 683 1.0E-29
sp|C4ZWI8|YBGL_ECOBW UPF0271 protein YbgL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ybgL PE=3 SV=1 436 683 1.0E-29
sp|B7LKQ8|YBGL_ESCF3 UPF0271 protein YbgL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ybgL PE=3 SV=1 436 686 3.0E-29
sp|B5YQQ2|YBGL_ECO5E UPF0271 protein YbgL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|Q8X9C8|YBGL_ECO57 UPF0271 protein YbgL OS=Escherichia coli O157:H7 GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|Q324J7|YBGL_SHIBS UPF0271 protein YbgL OS=Shigella boydii serotype 4 (strain Sb227) GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|A7ZXX4|YBGL_ECOHS UPF0271 protein YbgL OS=Escherichia coli O9:H4 (strain HS) GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|B7M5M7|YBGL_ECO8A UPF0271 protein YbgL OS=Escherichia coli O8 (strain IAI1) GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|B7LAB9|YBGL_ECO55 UPF0271 protein YbgL OS=Escherichia coli (strain 55989 / EAEC) GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|A7ZJ94|YBGL_ECO24 UPF0271 protein YbgL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ybgL PE=3 SV=1 436 683 8.0E-29
sp|B5R678|YBGL_SALG2 UPF0271 protein YbgL OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ybgL PE=3 SV=1 440 685 8.0E-29
sp|B5QWF7|YBGL_SALEP UPF0271 protein YbgL OS=Salmonella enteritidis PT4 (strain P125109) GN=ybgL PE=3 SV=1 440 685 8.0E-29
sp|B5FNE9|YBGL_SALDC UPF0271 protein YbgL OS=Salmonella dublin (strain CT_02021853) GN=ybgL PE=3 SV=1 440 685 8.0E-29
sp|B2TU96|YBGL_SHIB3 UPF0271 protein YbgL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ybgL PE=3 SV=1 436 683 9.0E-29
sp|Q32IM0|YBGL_SHIDS UPF0271 protein YbgL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ybgL PE=3 SV=1 436 683 9.0E-29
sp|B4TQ30|YBGL_SALSV UPF0271 protein YbgL OS=Salmonella schwarzengrund (strain CVM19633) GN=ybgL PE=3 SV=1 440 685 1.0E-28
sp|B5EZF1|YBGL_SALA4 UPF0271 protein YbgL OS=Salmonella agona (strain SL483) GN=ybgL PE=3 SV=1 440 685 1.0E-28
sp|B6I7Y4|YBGL_ECOSE UPF0271 protein YbgL OS=Escherichia coli (strain SE11) GN=ybgL PE=3 SV=1 436 683 1.0E-28
sp|B1IY16|YBGL_ECOLC UPF0271 protein YbgL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ybgL PE=3 SV=1 436 683 1.0E-28
sp|Q83S86|YBGL_SHIFL UPF0271 protein YbgL OS=Shigella flexneri GN=ybgL PE=3 SV=1 436 675 2.0E-28
sp|Q8ZQV6|YBGL_SALTY UPF0271 protein YbgL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ybgL PE=3 SV=1 440 685 2.0E-28
sp|Q8Z8D9|YBGL_SALTI UPF0271 protein YbgL OS=Salmonella typhi GN=ybgL PE=3 SV=1 440 685 2.0E-28
sp|B4SZB9|YBGL_SALNS UPF0271 protein YbgL OS=Salmonella newport (strain SL254) GN=ybgL PE=3 SV=1 440 685 3.0E-28
sp|Q8FJU6|YBGL_ECOL6 UPF0271 protein YbgL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybgL PE=3 SV=1 436 683 3.0E-28
sp|Q1REL0|YBGL_ECOUT UPF0271 protein YbgL OS=Escherichia coli (strain UTI89 / UPEC) GN=ybgL PE=3 SV=1 436 683 4.0E-28
sp|Q0TJX9|YBGL_ECOL5 UPF0271 protein YbgL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ybgL PE=3 SV=1 436 683 4.0E-28
sp|A1A8W9|YBGL_ECOK1 UPF0271 protein YbgL OS=Escherichia coli O1:K1 / APEC GN=ybgL PE=3 SV=1 436 683 4.0E-28
sp|B7MPK9|YBGL_ECO81 UPF0271 protein YbgL OS=Escherichia coli O81 (strain ED1a) GN=ybgL PE=3 SV=1 436 683 4.0E-28
sp|B7MFX2|YBGL_ECO45 UPF0271 protein YbgL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ybgL PE=3 SV=1 436 683 4.0E-28
sp|B7UKY6|YBGL_ECO27 UPF0271 protein YbgL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ybgL PE=3 SV=1 436 683 4.0E-28
sp|B4TBB5|YBGL_SALHS UPF0271 protein YbgL OS=Salmonella heidelberg (strain SL476) GN=ybgL PE=3 SV=1 440 685 5.0E-28
sp|Q57RM2|YBGL_SALCH UPF0271 protein YbgL OS=Salmonella choleraesuis (strain SC-B67) GN=ybgL PE=3 SV=2 440 685 5.0E-28
sp|A0PV23|Y4152_MYCUA UPF0271 protein MUL_4152 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_4152 PE=3 SV=1 440 675 7.0E-28
sp|B7NMQ9|YBGL_ECO7I UPF0271 protein YbgL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ybgL PE=3 SV=1 436 683 1.0E-27
sp|Q0T6V3|YBGL_SHIF8 UPF0271 protein YbgL OS=Shigella flexneri serotype 5b (strain 8401) GN=ybgL PE=3 SV=1 436 675 1.0E-27
sp|Q9RYM7|Y2984_DEIRA UPF0271 protein DR_A0284 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0284 PE=3 SV=2 432 685 1.0E-27
sp|C0PWD6|YBGL_SALPC UPF0271 protein YbgL OS=Salmonella paratyphi C (strain RKS4594) GN=ybgL PE=3 SV=1 440 685 2.0E-27
sp|B5BC95|YBGL_SALPK UPF0271 protein YbgL OS=Salmonella paratyphi A (strain AKU_12601) GN=ybgL PE=3 SV=1 440 685 4.0E-27
sp|Q5PCK6|YBGL_SALPA UPF0271 protein YbgL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ybgL PE=3 SV=1 440 685 4.0E-27
sp|A7MQV7|Y2634_CROS8 UPF0271 protein ESA_02634 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ESA_02634 PE=3 SV=1 436 685 5.0E-26
sp|B2HJ17|Y5076_MYCMM UPF0271 protein MMAR_5076 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_5076 PE=3 SV=1 440 675 1.0E-25
sp|A6W5D5|Y535_KINRD UPF0271 protein Krad_0535 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=Krad_0535 PE=3 SV=1 440 675 2.0E-23
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|761650
MSWEIGTRTQTILELNATRYSVFSNNDLPPPPSSPPDDLSSALEPFFSIAKDVVANRPVQNISGPRPLFPDGSAG
DPASIGMCVLLANWTGVDRESGLDYAGAAKDELDWLLSVIPRTDDGAISHRENELQLWSDSVYMVPPFLAYYGII
SNNQTLLMEAYNQIKLYRDYLRDSNAQNRWKHVVLGSGTDEGHWTTGNGWAAAGMLRVLATLRNSPFAQIMKDQQ
GDLTEWIEEIHDGMYAVLDTTANLWTNYPDVAADSPGNFYDTSGSALLAATVFRAAVMLNQFTHVPAAEKIRQTL
FSPSGGPPSSTTTSSTSTTTLATPTSPATAFPNYSHLTSEGWLNPVVNPYSFPHEGSMSPESEAFAIQLHSAWRD
WVADGARGANGGYTSLRLHGVGRTVALSVAVSVIFASWMRNPCIEPTIYLIPKLTEMARPLKATVNCDLGEGYSL
YRMGDDEELMKTIHLANVACGFHASDWDIMNQTVTYAKLYNVKVGAHPSLPDKQGFGRREMKISDTELFNCFVYQ
AGALFGFLKLHGMEMHHFKPHGAIYGQMARDLELARAGIRACRVFGDKVAFVGLAGTMHEAAASMEKVKFIPEWF
ADLKYDETGKLLITKTHDPVKEEDVVDRVNRLLQSRLITTNESGKFLPLGDNVEEVTICVHSDTPGAVKIAQLVK
KLVDEHNLSLRL*
Coding >Agabi119p4|761650
ATGAGTTGGGAAATAGGTACAAGAACACAAACGATCCTCGAACTCAACGCAACACGTTACTCAGTGTTTTCCAAC
AACGACTTACCACCACCACCCTCTTCGCCTCCCGATGATTTATCTTCCGCTCTCGAACCCTTTTTCTCGATCGCC
AAGGATGTGGTGGCTAATAGACCGGTTCAAAATATCTCAGGGCCGAGACCACTATTCCCCGATGGTAGTGCTGGA
GATCCAGCATCAATAGGTATGTGTGTCTTGTTGGCGAATTGGACTGGAGTAGATCGGGAGAGTGGGTTGGATTAT
GCTGGTGCAGCTAAGGATGAATTAGATTGGTTGTTGAGTGTAATCCCCCGGACGGATGATGGAGCTATTTCGCAT
CGAGAGAACGAGCTTCAACTTTGGAGTGACTCTGTGTATATGGTTCCTCCCTTCCTGGCTTACTACGGTATCATA
TCAAATAACCAGACGTTATTAATGGAAGCGTACAACCAAATCAAATTGTATAGAGATTATCTGCGGGATTCAAAT
GCTCAAAACCGGTGGAAACATGTCGTACTTGGTAGTGGTACCGATGAGGGGCATTGGACGACCGGTAATGGATGG
GCTGCAGCTGGAATGCTCCGCGTTTTGGCTACACTTCGTAATTCCCCATTTGCGCAGATAATGAAAGATCAACAA
GGAGATTTAACAGAATGGATAGAAGAAATTCACGATGGGATGTATGCCGTTCTCGATACCACAGCGAACCTATGG
ACGAACTATCCAGATGTCGCCGCCGATTCGCCAGGCAACTTTTATGATACTTCTGGTTCCGCTCTATTGGCCGCT
ACGGTGTTCAGGGCGGCTGTCATGTTGAATCAGTTTACGCATGTGCCTGCTGCAGAGAAGATTAGACAAACGTTG
TTTTCACCATCTGGGGGACCACCGTCTTCAACAACGACATCATCTACTTCTACAACGACATTAGCAACGCCAACA
TCACCAGCGACAGCGTTCCCAAATTACAGCCACTTGACATCAGAAGGTTGGCTAAACCCTGTCGTCAACCCGTAT
TCATTCCCTCATGAAGGATCAATGTCGCCCGAATCGGAAGCATTCGCGATTCAACTGCATTCGGCTTGGAGGGAT
TGGGTTGCCGACGGAGCGAGGGGAGCGAACGGTGGATATACCAGTCTACGATTACACGGTGTGGGCAGGACTGTG
GCGCTTTCTGTCGCTGTCAGTGTCATCTTTGCCAGTTGGATGAGAAACCCCTGTATTGAACCTACTATCTACTTG
ATACCCAAACTTACAGAGATGGCAAGACCTTTGAAAGCCACCGTTAACTGTGATCTAGGCGAAGGGTACAGTCTT
TATCGTATGGGAGACGATGAAGAACTCATGAAAACTATTCACTTGGCCAATGTCGCATGTGGTTTCCATGCCTCA
GATTGGGACATCATGAACCAAACCGTCACGTACGCAAAACTCTACAACGTTAAAGTGGGTGCACATCCTTCGTTG
CCGGATAAACAAGGGTTCGGTCGAAGGGAGATGAAAATCTCTGATACGGAATTGTTTAATTGTTTCGTGTACCAA
GCCGGCGCTTTGTTCGGTTTTCTCAAGCTCCATGGCATGGAGATGCACCACTTCAAACCGCATGGGGCAATTTAT
GGACAGATGGCTAGGGATCTGGAGTTGGCGAGAGCTGGCATTAGGGCTTGCAGAGTCTTCGGTGACAAAGTAGCA
TTTGTTGGATTAGCTGGGACGATGCATGAAGCTGCGGCGAGCATGGAAAAAGTTAAATTCATACCAGAATGGTTT
GCCGATTTAAAATATGACGAAACTGGTAAACTCTTGATTACGAAGACACATGATCCAGTAAAAGAGGAGGACGTT
GTCGATCGGGTGAATCGGCTCCTTCAAAGCCGGTTGATTACAACGAATGAATCTGGAAAGTTCCTCCCTCTTGGT
GATAATGTCGAAGAAGTGACTATCTGCGTCCATTCTGATACCCCGGGCGCCGTCAAAATCGCGCAGCTCGTTAAG
AAACTCGTGGATGAACATAACCTCAGTCTGAGACTCTGA
Transcript >Agabi119p4|761650
ATGAGTTGGGAAATAGGTACAAGAACACAAACGATCCTCGAACTCAACGCAACACGTTACTCAGTGTTTTCCAAC
AACGACTTACCACCACCACCCTCTTCGCCTCCCGATGATTTATCTTCCGCTCTCGAACCCTTTTTCTCGATCGCC
AAGGATGTGGTGGCTAATAGACCGGTTCAAAATATCTCAGGGCCGAGACCACTATTCCCCGATGGTAGTGCTGGA
GATCCAGCATCAATAGGTATGTGTGTCTTGTTGGCGAATTGGACTGGAGTAGATCGGGAGAGTGGGTTGGATTAT
GCTGGTGCAGCTAAGGATGAATTAGATTGGTTGTTGAGTGTAATCCCCCGGACGGATGATGGAGCTATTTCGCAT
CGAGAGAACGAGCTTCAACTTTGGAGTGACTCTGTGTATATGGTTCCTCCCTTCCTGGCTTACTACGGTATCATA
TCAAATAACCAGACGTTATTAATGGAAGCGTACAACCAAATCAAATTGTATAGAGATTATCTGCGGGATTCAAAT
GCTCAAAACCGGTGGAAACATGTCGTACTTGGTAGTGGTACCGATGAGGGGCATTGGACGACCGGTAATGGATGG
GCTGCAGCTGGAATGCTCCGCGTTTTGGCTACACTTCGTAATTCCCCATTTGCGCAGATAATGAAAGATCAACAA
GGAGATTTAACAGAATGGATAGAAGAAATTCACGATGGGATGTATGCCGTTCTCGATACCACAGCGAACCTATGG
ACGAACTATCCAGATGTCGCCGCCGATTCGCCAGGCAACTTTTATGATACTTCTGGTTCCGCTCTATTGGCCGCT
ACGGTGTTCAGGGCGGCTGTCATGTTGAATCAGTTTACGCATGTGCCTGCTGCAGAGAAGATTAGACAAACGTTG
TTTTCACCATCTGGGGGACCACCGTCTTCAACAACGACATCATCTACTTCTACAACGACATTAGCAACGCCAACA
TCACCAGCGACAGCGTTCCCAAATTACAGCCACTTGACATCAGAAGGTTGGCTAAACCCTGTCGTCAACCCGTAT
TCATTCCCTCATGAAGGATCAATGTCGCCCGAATCGGAAGCATTCGCGATTCAACTGCATTCGGCTTGGAGGGAT
TGGGTTGCCGACGGAGCGAGGGGAGCGAACGGTGGATATACCAGTCTACGATTACACGGTGTGGGCAGGACTGTG
GCGCTTTCTGTCGCTGTCAGTGTCATCTTTGCCAGTTGGATGAGAAACCCCTGTATTGAACCTACTATCTACTTG
ATACCCAAACTTACAGAGATGGCAAGACCTTTGAAAGCCACCGTTAACTGTGATCTAGGCGAAGGGTACAGTCTT
TATCGTATGGGAGACGATGAAGAACTCATGAAAACTATTCACTTGGCCAATGTCGCATGTGGTTTCCATGCCTCA
GATTGGGACATCATGAACCAAACCGTCACGTACGCAAAACTCTACAACGTTAAAGTGGGTGCACATCCTTCGTTG
CCGGATAAACAAGGGTTCGGTCGAAGGGAGATGAAAATCTCTGATACGGAATTGTTTAATTGTTTCGTGTACCAA
GCCGGCGCTTTGTTCGGTTTTCTCAAGCTCCATGGCATGGAGATGCACCACTTCAAACCGCATGGGGCAATTTAT
GGACAGATGGCTAGGGATCTGGAGTTGGCGAGAGCTGGCATTAGGGCTTGCAGAGTCTTCGGTGACAAAGTAGCA
TTTGTTGGATTAGCTGGGACGATGCATGAAGCTGCGGCGAGCATGGAAAAAGTTAAATTCATACCAGAATGGTTT
GCCGATTTAAAATATGACGAAACTGGTAAACTCTTGATTACGAAGACACATGATCCAGTAAAAGAGGAGGACGTT
GTCGATCGGGTGAATCGGCTCCTTCAAAGCCGGTTGATTACAACGAATGAATCTGGAAAGTTCCTCCCTCTTGGT
GATAATGTCGAAGAAGTGACTATCTGCGTCCATTCTGATACCCCGGGCGCCGTCAAAATCGCGCAGCTCGTTAAG
AAACTCGTGGATGAACATAACCTCAGTCTGAGACTCTGA
Gene >Agabi119p4|761650
ATGAGTTGGGAAATAGGTACAAGAACACAAACGATCCTCGAACTCAACGCAACACGTTACTCAGTGTTTTCCAAC
AACGACTTACCACCACCACCCTCTTCGCCTCCCGATGATTTATCTTCCGCTCTCGAACCCTTTTTCTCGATCGCC
AAGGATGTGGTGGCTAATAGACCGGTTCAAAATATCTCAGGGCCGAGACCACTATTCCCCGATGGTAGTGCTGGA
GATCCAGCATCAATAGGTATGTGTGTCTTGTTGGCGAATTGGACTGGAGTAGATCGGGAGAGTGGGTTGGATTAT
GCTGGTGCAGCTAAGGATGAATTAGATTGGTTGTTGAGTGTAATCCCCCGGACGGATGATGGAGCTATTTCGCAT
CGAGAGAACGAGCTTCAACTTTGGTACGCAGTCAGTCTCGCCTGTTTTCATCCTTCGTCTAAATTTGCAAAGGAG
TGACTCTGTGTATATGGTTCCTCCCTTCCTGGCTTACTACGGTATCATATCAAATAACCAGACGTTATTAATGGA
AGCGTACAACCAAATCAAATTGTATAGAGATTATCTGCGGGATTCAAATGCTCAAAACCGGTGGAAACATGTCGT
ACTTGGTAGTGGTACCGATGAGGGGCATTGGACGACCGGTATGTCTCCGTAGGTGGCTTGCATACGACCAGTGTA
CAGAGCTTATATTCCTTCAGGTAATGGATGGGCTGCAGCTGGAATGCTCCGCGTTTTGGCTACACTTCGTAATTC
CCCATTTGCGCAGATAATGAAAGATCAACAAGGAGATTTAACAGAATGGATAGAAGAAATTCACGATGGGATGTA
TGCCGTTCTCGTACGCCTATTTGTTTTGCTCTCTATTTCGCGGCCTTTAATAATCAGGGTTGAACTTTAAAATAC
AGGATACCACAGCGAACCTATGGACGAACTATCCAGATGTCGCCGCCGATTCGCCAGGCAACTTTTATGATACTT
CTGGTTCCGCTCTATTGGCCGCTACGGTGTTCAGGGCGGCTGTCATGTTGAATCAGTTTACGCATGTGCCTGCTG
CAGAGAAGATTAGACAAACGTTGTTTTCACCATCTGGGGGACCACCGTCTTCAACAACGACATCATCTACTTCTA
CAACGACATTAGCAACGCCAACATCACCAGCGACAGCGTTCCCAAATTACAGCCACTTGACATCAGAAGGTTGGC
TAAACCCTGTCGTCAACCCGTATTCATTCCCTCATGAAGGATCAATGTCGCCCGAATCGGAAGCATTCGCGATTC
AACTGCATTCGGCTTGGAGGGATTGGGTTGCCGACGGAGCGAGGGGAGCGAACGGTGGATATACCAGTCTACGAT
TACACGGTGTGGGCAGGACTGTGGCGCTTTCTGTCGCTGTCAGTGTCATCTTTGCCAGTTGGATGAGAGTGTGTT
AAAGTTAGCCGTGGGACTTTGAACCGGACCTTATAATATTTCACGTGTTTGTAATTAGCCAGGGTCATTGACTAT
TCTTCACAGAACCCCTGTATTGAACCTACTATCTACTTGATACCCAAACTTACAGAGATGGCAAGACCTTTGAAA
GCCACCGTTAACTGTGATCTAGGCGAAGTAAGCTCACCCTGTCCTGTCGTTTCATGTTGTATCGACTTCGACGTC
AACCGTATAGGGGTACAGTCTTTATCGTATGGTAAGCTTAAAAAACCCCGTTTACCAATCCTTGCCGTTAAAGGT
TTCTGTAGGGAGACGATGAAGAACTCATGAAAACTATTCACTTGGCCAATGTCGCATGTGGTTTCCATGCCTCGT
AAGTTCTCACCAGGTTTGATCCGATCCAAATCTTTGCCTTATGCTAATGCGAGGCGTCAATAAGAGATTGGGACA
TCATGAACCAAACCGTCACGTACGCAAAACTCTACAACGTTAAAGTGGGTGCACATCCTTCGTTGCCGGATAAAC
AAGGGTTCGGTCGAAGGGAGATGAAAATCTCTGATGTACGTTCACTCATGTTTGTTATTCTCGTACTATGCAACA
ACATCAACCCCTGTCTCCCATCTATCCAGACGGAATTGTTTAATTGTTTCGTGTACCAAGCCGGCGCTTTGTTCG
GTTTTCTCAAGCTCCATGGCATGGAGATGCACCACTTCAAACCGCATGGGGCAATTTATGGACAGATGGCTAGGG
ATCTGGAGTTGGCGAGAGCTGGCATTAGGGCTTGCAGAGTCTTCGGTGACAAAGTAGCATTTGTTGGATTAGCTG
GGACGATGCATGAAGCTGCGGCGAGCATGGAAAAAGTTAAATTCATACCAGGTAAGCCCCACTTTCTTTCTTTCT
CTTTTTCTTTCAGATTCGTCGAGCGATCAACATATCTGATATGTATTTAGAATGGTTTGCCGATTTAAAATATGA
CGAAACTGGTAAACTCTTGATTACGAAGTAAGTGTTTCCTATGAGGCTGTGGCTTTCATTTATTCAAAATGGATG
TTCTTAGGACACATGATCCAGTAAAAGAGGAGGACGTTGTCGATCGGGTGAGTTCCCTCGTCGAAATTCATGCTA
CAACTTCCTCGCAGAGTTAATGCCGAAACTTGCTTAAAGGTGAATCGGCTCCTTCAAAGCCGGTTGATTACAACG
AATGAATCTGGAAAGTTCCTCCCTCTTGGTGATAATGTCGAAGAAGTGACTATCTGCGTCCATTCTGATACCCCG
GTCAGTATTTCTTTTTCTCTTTAATAACATGCCAACGAGGTTGACGCCTTTTAAGGGCGCCGTCAAAATCGCGCA
GCTCGTTAAGAAACTCGTGGATGAACATAACCTCAGTCTGAGACTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail