Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|761400
Gene name
Locationscaffold_11:1659376..1663188
Strand+
Gene length (bp)3812
Transcript length (bp)3081
Coding sequence length (bp)3081
Protein length (aa) 1027

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16653 Sacchrp_dh_C Saccharopine dehydrogenase C-terminal domain 1.2E-77 647 1003
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 4.4E-16 525 640
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 5.6E-12 22 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1 4 1003 1.0E-147
sp|Q99K67|AASS_MOUSE Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus GN=Aass PE=1 SV=1 4 1003 1.0E-145
sp|A2VCW9|AASS_RAT Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Rattus norvegicus GN=Aass PE=2 SV=1 4 1003 6.0E-145
sp|A8E657|AASS_BOVIN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus GN=AASS PE=2 SV=1 4 1003 1.0E-144
sp|Q54NG9|SCPDH_DICDI Probable saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Dictyostelium discoideum GN=sdh PE=2 SV=1 522 1008 1.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1 4 1003 1.0E-147
sp|Q99K67|AASS_MOUSE Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus GN=Aass PE=1 SV=1 4 1003 1.0E-145
sp|A2VCW9|AASS_RAT Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Rattus norvegicus GN=Aass PE=2 SV=1 4 1003 6.0E-145
sp|A8E657|AASS_BOVIN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus GN=AASS PE=2 SV=1 4 1003 1.0E-144
sp|Q54NG9|SCPDH_DICDI Probable saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Dictyostelium discoideum GN=sdh PE=2 SV=1 522 1008 1.0E-68
sp|Q9SMZ4|AASS_ARATH Alpha-aminoadipic semialdehyde synthase OS=Arabidopsis thaliana GN=LKR/SDH PE=1 SV=1 519 1010 2.0E-64
sp|P38999|LYS9_YEAST Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS9 PE=1 SV=1 522 1000 3.0E-63
sp|Q9P4R4|LYS9_MAGO7 Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LYS3 PE=1 SV=2 522 1000 8.0E-63
sp|O59711|LYS9_SCHPO Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys9 PE=3 SV=1 524 1009 3.0E-61
sp|Q9SMZ4|AASS_ARATH Alpha-aminoadipic semialdehyde synthase OS=Arabidopsis thaliana GN=LKR/SDH PE=1 SV=1 24 482 4.0E-59
sp|Q6FU27|LYS1_CANGA Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS1 PE=3 SV=1 10 272 1.0E-11
sp|Q870G1|LYS1_EMENI Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lysA PE=3 SV=2 25 175 5.0E-09
sp|P43065|LYS1_CANAX Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Candida albicans GN=LYS1 PE=3 SV=1 11 175 3.0E-08
sp|P38998|LYS1_YEAST Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS1 PE=1 SV=3 11 175 7.0E-08
sp|Q09694|LYS1_SCHPO Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys3 PE=1 SV=2 25 245 2.0E-07
sp|P38997|LYS1_YARLI Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LYS5 PE=3 SV=1 11 175 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|761400
MKPSRSLLQNVVLAMRREDPARIWERRAPLTPDAVHHLVEKDGVEVLVEPCERRVFTAHEYEKAGAKITSSFDRA
HVVIGIKENPMDALAGQRAPVANGNIPRTQVMFSHTAKGQTYNTGLLSQFVAPTDGVLAPSAAEFEKTLELWPRL
IDYELLTDDKGKRTVGFGWYAGVAGVLESLSAMAHAHLELGIASPFLYTPRPHTLPCLERLRVALREVGQWISTQ
GTPRALGPLVICVTGTGNVAQGCLSILEDLPLKKIDVRELESLVRSDGTSDLFTLAQLLTMNDQIYLVHAKPQDY
LVRKDGKSYDRQDYYANPSEWQSLFGERIMPYVTLFLNGTGWASGFPSILTTQQLSNAIAKAQSLGIPSAVTRAR
CIGDISCDIGGGLEFLERSTTISEPTYKFAVSDTSGDITMMSVDILPTALPLDASRHFSKEFFPYLRTLINQVGK
SNNKGGGEELTRALERATIASNGKLKEKHEWLQPAVDQWHQEQRGVKGIQHMNDSVQVGGTGADRIRGVKKKKMV
MFGSGMVAGPAVEEIAKRGDVELVIATNLLGEAQKLAIRYGQEHNNIKYRIVDVAKKETYEHLVNEADVVISLLP
AAYHVDIAEMCISGKKHLVTASYISEPMRHLHDRALSADVLLLNEIGLDPGIDHCSAISLINDLKAKGKQVVSFT
SFCGGLPAPDSIFDTSSSSSMMMKKRAVPLKYKFSWSPVGVLRAANQGVRYLLNDKVVKLPGMELLRSGFPRLPI
LSGKEGDGDGVELEGMPNRDSLPYRETYGLRGEEGESLRTLVRGTLRYPGFCSLMQSFKDIGLLEDGRKIQIGEW
NEFLRQVLAVRLGSSSSLGLDGSLESALRDVQGVGEKQYEETMGALEWLGLLSNSNGGGGKKMMVPMKEATPLEL
FAMVLGNKLKYGPMERDMVVLSHEVIVRNNQNQQQPQQEEVHRSTLVAYGDESASAMAKTVGLPVAFAALDVLDG
KVGMRGVCGPNEREIYESVLGRLEEVGLGMVESVDLVGREGLRTVEESLRG*
Coding >Agabi119p4|761400
ATGAAGCCCTCCCGATCACTGTTGCAGAATGTTGTCCTCGCCATGCGCAGAGAGGATCCAGCGAGGATCTGGGAA
CGTCGCGCTCCTCTCACCCCCGACGCCGTCCACCATCTCGTCGAGAAGGACGGCGTCGAGGTCCTTGTCGAGCCC
TGCGAACGACGTGTCTTTACAGCTCATGAATACGAAAAGGCTGGCGCAAAGATCACTTCCTCCTTTGACCGAGCA
CACGTTGTGATAGGCATCAAAGAGAATCCAATGGACGCACTCGCAGGCCAGCGGGCTCCTGTTGCCAATGGAAAC
ATACCCCGCACACAAGTCATGTTCTCACATACCGCCAAAGGCCAAACCTACAACACCGGTCTGCTATCTCAGTTT
GTCGCCCCGACAGACGGCGTCCTCGCACCATCTGCAGCCGAATTTGAAAAGACGCTTGAGCTGTGGCCGCGGTTG
ATTGATTATGAGCTTTTGACCGACGACAAAGGCAAGCGCACTGTAGGATTTGGATGGTATGCAGGTGTCGCCGGT
GTCCTTGAATCCTTGTCCGCCATGGCTCACGCCCACCTCGAACTCGGCATCGCCTCTCCCTTTCTCTACACGCCC
CGACCTCATACGCTTCCGTGTCTTGAACGCCTTCGTGTTGCATTGCGCGAGGTTGGACAATGGATTTCTACGCAG
GGTACTCCAAGGGCCCTTGGTCCTTTGGTTATCTGCGTCACTGGAACGGGTAACGTTGCTCAGGGGTGCCTCTCC
ATCCTCGAGGACCTGCCACTGAAGAAGATTGATGTACGTGAATTAGAGAGTCTCGTACGCTCAGACGGCACGTCG
GACTTGTTCACACTCGCTCAACTACTGACAATGAATGACCAGATATACTTGGTGCACGCGAAACCACAAGATTAT
TTAGTTCGGAAAGACGGCAAGTCATATGATCGCCAGGATTATTATGCAAACCCTAGCGAGTGGCAAAGTCTATTT
GGCGAACGCATTATGCCCTATGTGACTCTTTTCCTCAATGGCACCGGGTGGGCATCCGGTTTCCCTTCCATCTTG
ACTACCCAGCAACTTTCAAATGCTATTGCGAAAGCGCAGTCTCTTGGTATTCCTAGTGCTGTCACCAGAGCTAGA
TGCATCGGTGATATCAGCTGCGATATTGGGGGAGGCCTTGAATTCCTGGAACGTTCAACTACGATCTCTGAACCG
ACTTACAAATTTGCTGTTTCTGATACGAGTGGCGATATCACCATGATGTCAGTTGATATTCTCCCCACTGCACTT
CCGTTAGACGCATCGCGACATTTTTCGAAAGAATTTTTCCCTTATCTTCGTACACTCATAAATCAAGTTGGGAAG
AGTAATAATAAGGGTGGTGGTGAAGAGTTGACGAGAGCACTTGAGAGAGCGACGATTGCGTCTAATGGAAAATTG
AAGGAGAAGCATGAATGGTTGCAGCCTGCGGTGGATCAATGGCATCAAGAACAAAGAGGTGTGAAAGGAATACAA
CATATGAATGATTCTGTTCAAGTTGGTGGGACTGGTGCGGATAGGATTAGAGGTGTGAAGAAGAAGAAGATGGTG
ATGTTTGGAAGTGGGATGGTTGCTGGACCTGCGGTTGAGGAGATTGCGAAAAGGGGGGATGTTGAACTTGTTATT
GCGACGAATTTACTGGGAGAGGCTCAGAAGCTTGCGATACGATATGGACAGGAACATAATAATATCAAGTATCGG
ATTGTGGATGTTGCGAAGAAGGAGACTTATGAGCATTTGGTTAATGAGGCGGATGTTGTCATCAGTTTGTTACCT
GCGGCATATCATGTTGATATTGCGGAGATGTGTATTTCGGGAAAGAAACATCTCGTTACTGCATCTTACATCTCC
GAACCCATGCGTCATCTCCATGATCGAGCCTTATCAGCTGATGTGTTGCTGCTTAATGAAATTGGACTTGATCCG
GGGATAGATCATTGTTCAGCGATTTCGTTGATCAATGATTTGAAAGCAAAGGGAAAACAAGTTGTTTCGTTTACG
TCGTTTTGTGGAGGATTGCCTGCACCGGATTCGATATTCGATACGTCGTCGTCGTCGTCGATGATGATGAAGAAG
AGGGCGGTACCGTTGAAGTATAAATTTAGTTGGAGTCCTGTGGGTGTTTTGAGAGCTGCGAATCAGGGGGTGAGG
TATTTGCTAAATGACAAGGTTGTGAAACTTCCGGGGATGGAGTTACTTCGGTCTGGGTTTCCGAGGTTACCGATT
TTGAGTGGGAAGGAGGGTGATGGTGATGGCGTAGAGTTGGAGGGGATGCCGAATAGAGATAGTTTGCCGTATAGG
GAGACTTATGGATTACGAGGTGAGGAGGGTGAGAGTTTGAGGACGTTGGTGCGAGGTACACTTCGGTATCCGGGG
TTTTGTTCTTTGATGCAGTCGTTTAAGGATATTGGGTTGCTTGAAGATGGGAGGAAAATTCAAATTGGGGAGTGG
AATGAGTTTTTGAGGCAAGTGCTTGCTGTGAGACTTGGATCGTCATCGTCGTTGGGTTTGGATGGGAGTTTGGAA
AGTGCTCTTAGGGATGTGCAAGGGGTCGGAGAGAAGCAGTATGAGGAGACGATGGGTGCGTTGGAGTGGTTGGGT
TTGTTGTCGAATTCGAATGGAGGAGGAGGGAAGAAGATGATGGTTCCGATGAAGGAAGCTACGCCTTTAGAGTTG
TTTGCTATGGTTTTGGGAAACAAGTTGAAGTATGGGCCGATGGAAAGGGATATGGTCGTACTCTCTCATGAAGTT
ATCGTTCGCAACAACCAAAACCAACAACAACCTCAACAAGAAGAAGTTCATCGATCGACTCTAGTCGCATATGGA
GATGAATCCGCATCTGCTATGGCGAAAACGGTTGGTCTTCCTGTGGCGTTTGCAGCGCTAGATGTGTTGGATGGG
AAAGTGGGGATGAGAGGGGTGTGTGGACCGAATGAGAGGGAGATTTATGAGAGTGTTTTGGGGAGGTTGGAGGAG
GTTGGGTTGGGGATGGTTGAGAGTGTGGATTTGGTTGGGAGGGAGGGGTTGAGGACTGTAGAGGAGAGTTTGAGG
GGGTAA
Transcript >Agabi119p4|761400
ATGAAGCCCTCCCGATCACTGTTGCAGAATGTTGTCCTCGCCATGCGCAGAGAGGATCCAGCGAGGATCTGGGAA
CGTCGCGCTCCTCTCACCCCCGACGCCGTCCACCATCTCGTCGAGAAGGACGGCGTCGAGGTCCTTGTCGAGCCC
TGCGAACGACGTGTCTTTACAGCTCATGAATACGAAAAGGCTGGCGCAAAGATCACTTCCTCCTTTGACCGAGCA
CACGTTGTGATAGGCATCAAAGAGAATCCAATGGACGCACTCGCAGGCCAGCGGGCTCCTGTTGCCAATGGAAAC
ATACCCCGCACACAAGTCATGTTCTCACATACCGCCAAAGGCCAAACCTACAACACCGGTCTGCTATCTCAGTTT
GTCGCCCCGACAGACGGCGTCCTCGCACCATCTGCAGCCGAATTTGAAAAGACGCTTGAGCTGTGGCCGCGGTTG
ATTGATTATGAGCTTTTGACCGACGACAAAGGCAAGCGCACTGTAGGATTTGGATGGTATGCAGGTGTCGCCGGT
GTCCTTGAATCCTTGTCCGCCATGGCTCACGCCCACCTCGAACTCGGCATCGCCTCTCCCTTTCTCTACACGCCC
CGACCTCATACGCTTCCGTGTCTTGAACGCCTTCGTGTTGCATTGCGCGAGGTTGGACAATGGATTTCTACGCAG
GGTACTCCAAGGGCCCTTGGTCCTTTGGTTATCTGCGTCACTGGAACGGGTAACGTTGCTCAGGGGTGCCTCTCC
ATCCTCGAGGACCTGCCACTGAAGAAGATTGATGTACGTGAATTAGAGAGTCTCGTACGCTCAGACGGCACGTCG
GACTTGTTCACACTCGCTCAACTACTGACAATGAATGACCAGATATACTTGGTGCACGCGAAACCACAAGATTAT
TTAGTTCGGAAAGACGGCAAGTCATATGATCGCCAGGATTATTATGCAAACCCTAGCGAGTGGCAAAGTCTATTT
GGCGAACGCATTATGCCCTATGTGACTCTTTTCCTCAATGGCACCGGGTGGGCATCCGGTTTCCCTTCCATCTTG
ACTACCCAGCAACTTTCAAATGCTATTGCGAAAGCGCAGTCTCTTGGTATTCCTAGTGCTGTCACCAGAGCTAGA
TGCATCGGTGATATCAGCTGCGATATTGGGGGAGGCCTTGAATTCCTGGAACGTTCAACTACGATCTCTGAACCG
ACTTACAAATTTGCTGTTTCTGATACGAGTGGCGATATCACCATGATGTCAGTTGATATTCTCCCCACTGCACTT
CCGTTAGACGCATCGCGACATTTTTCGAAAGAATTTTTCCCTTATCTTCGTACACTCATAAATCAAGTTGGGAAG
AGTAATAATAAGGGTGGTGGTGAAGAGTTGACGAGAGCACTTGAGAGAGCGACGATTGCGTCTAATGGAAAATTG
AAGGAGAAGCATGAATGGTTGCAGCCTGCGGTGGATCAATGGCATCAAGAACAAAGAGGTGTGAAAGGAATACAA
CATATGAATGATTCTGTTCAAGTTGGTGGGACTGGTGCGGATAGGATTAGAGGTGTGAAGAAGAAGAAGATGGTG
ATGTTTGGAAGTGGGATGGTTGCTGGACCTGCGGTTGAGGAGATTGCGAAAAGGGGGGATGTTGAACTTGTTATT
GCGACGAATTTACTGGGAGAGGCTCAGAAGCTTGCGATACGATATGGACAGGAACATAATAATATCAAGTATCGG
ATTGTGGATGTTGCGAAGAAGGAGACTTATGAGCATTTGGTTAATGAGGCGGATGTTGTCATCAGTTTGTTACCT
GCGGCATATCATGTTGATATTGCGGAGATGTGTATTTCGGGAAAGAAACATCTCGTTACTGCATCTTACATCTCC
GAACCCATGCGTCATCTCCATGATCGAGCCTTATCAGCTGATGTGTTGCTGCTTAATGAAATTGGACTTGATCCG
GGGATAGATCATTGTTCAGCGATTTCGTTGATCAATGATTTGAAAGCAAAGGGAAAACAAGTTGTTTCGTTTACG
TCGTTTTGTGGAGGATTGCCTGCACCGGATTCGATATTCGATACGTCGTCGTCGTCGTCGATGATGATGAAGAAG
AGGGCGGTACCGTTGAAGTATAAATTTAGTTGGAGTCCTGTGGGTGTTTTGAGAGCTGCGAATCAGGGGGTGAGG
TATTTGCTAAATGACAAGGTTGTGAAACTTCCGGGGATGGAGTTACTTCGGTCTGGGTTTCCGAGGTTACCGATT
TTGAGTGGGAAGGAGGGTGATGGTGATGGCGTAGAGTTGGAGGGGATGCCGAATAGAGATAGTTTGCCGTATAGG
GAGACTTATGGATTACGAGGTGAGGAGGGTGAGAGTTTGAGGACGTTGGTGCGAGGTACACTTCGGTATCCGGGG
TTTTGTTCTTTGATGCAGTCGTTTAAGGATATTGGGTTGCTTGAAGATGGGAGGAAAATTCAAATTGGGGAGTGG
AATGAGTTTTTGAGGCAAGTGCTTGCTGTGAGACTTGGATCGTCATCGTCGTTGGGTTTGGATGGGAGTTTGGAA
AGTGCTCTTAGGGATGTGCAAGGGGTCGGAGAGAAGCAGTATGAGGAGACGATGGGTGCGTTGGAGTGGTTGGGT
TTGTTGTCGAATTCGAATGGAGGAGGAGGGAAGAAGATGATGGTTCCGATGAAGGAAGCTACGCCTTTAGAGTTG
TTTGCTATGGTTTTGGGAAACAAGTTGAAGTATGGGCCGATGGAAAGGGATATGGTCGTACTCTCTCATGAAGTT
ATCGTTCGCAACAACCAAAACCAACAACAACCTCAACAAGAAGAAGTTCATCGATCGACTCTAGTCGCATATGGA
GATGAATCCGCATCTGCTATGGCGAAAACGGTTGGTCTTCCTGTGGCGTTTGCAGCGCTAGATGTGTTGGATGGG
AAAGTGGGGATGAGAGGGGTGTGTGGACCGAATGAGAGGGAGATTTATGAGAGTGTTTTGGGGAGGTTGGAGGAG
GTTGGGTTGGGGATGGTTGAGAGTGTGGATTTGGTTGGGAGGGAGGGGTTGAGGACTGTAGAGGAGAGTTTGAGG
GGGTAA
Gene >Agabi119p4|761400
ATGAAGCCCTCCCGATCACTGTTGCAGAATGTTGTCCTCGCCATGCGCAGAGAGGATCCAGCGAGGATCTGGGAA
CGTCGCGCTCCTCTCACCCCCGACGCCGTCCACCATCTCGTCGAGAAGGACGGCGTCGAGGTCCTTGTCGAGCCC
TGCGAACGACGTGTCTTTACAGCTCATGAATACGAAAAGGTAAGAGCGATCCTTTGATAGTGTGGCATTGACATC
TCATCCTCGACAGGCTGGCGCAAAGATCACTTCCTCCTTTGACCGAGCACACGTTGTGATAGGCATCAAAGAGAA
TCCAATGGACGCACTCGCAGGCCAGCGGGCTCCTGTTGCCAATGGAAACATACCCCGCACACAAGTCATGTTCTC
ACATACCGCCAAAGGCCAAACCTACAACACCGGTCTGCTATCTCAGTTTGTCGCCCCGACAGACGGCGTCCTCGC
ACCATCTGCAGCCGAATTTGAAAAGACGCTTGAGCTGTGGCCGCGGTTGATTGATTATGAGCTTTTGACCGACGA
CAAAGGCAAGCGCACTGTAGGATTTGGATGGTATGCAGGTGGTAAGTGGATCCTCCCACGCATACACTTAGGGGT
TGCTAATGACGTCCTAGTCGCCGGTGTCCTTGAATCCTTGTCCGCCATGGCTCACGCCCACCTCGAACTCGGCAT
CGCCTCTCCCTTTCTCGTGAGTATCCACCGCCAGCACAGAGACTATCTCACGCAAAGGCCGGAGACAATCTGGAC
GACAACCCATAACCTGACTCTAATACTTTCCTTCCACTTAGTACACGCCCCGACCTCATACGCTTCCGTGTCTTG
AACGCCTTCGTGTTGCATTGCGCGAGGTTGGACAATGGATTTCTACGCAGGGTACTCCAAGGGCCCTTGGTCCTT
TGGTTATCTGCGTCACTGGGTGCGTCACTCGACATCCGCTCATCCCCATTTTAATGATATCCTATTTTTAGAACG
GGTAACGTTGCTCAGGGGTGCCTCTCCATCCTCGAGGACCTGCCACTGAAGAAGATTGATGTACGTGAATTAGAG
AGTCTCGTACGCTCAGACGGTGAGCAGCTTACTTTTTCACGCTCGTGCTTGCTGCTCACGAAGTGTAGATTATGA
TAACTCCAAGGCACGTCGGACTTGTTCACACTCGCTCAACTACTGACAATGAATGACCAGATATACTTGGTGCAC
GCGAAACCACAAGATTATTTAGTTCGGAAAGACGGCAAGTCATATGATCGCCAGGATTATTATGCAAACCCTAGC
GAGTGGCAAAGTCTATTTGGCGAACGCGTACGTGTCGTTATTGTCCTAGCGAGTCCTGTCCCTCAACTCTTGCGA
TTCAGATTATGCCCTATGTGACTCTTTTCCTCAATGGCACCGGGTGGGCATCCGGTTTCCCTTCCATCTTGACTA
CCCAGCAACTTTCAAATGCTATTGCGAAAGCGCAGTCTCTTGGTATTCCTAGTGCTGTCACCAGAGCTAGATGCA
TCGGTGATATCAGCTGCGATATTGGGGTATGTGAATGTTTTTGATTCATCGTTTCTTTCCCTCTGATACTCTGAT
AGGGAGGCCTTGAATTCCTGGAACGTTCAACTACGATCTCTGAACCGACTTACAAATTTGCTGTTTCTGATACGA
GTGGCGATATCACCATGATGTCAGTTGATATTCTCCCCACTGCACTTCCGTTAGACGCATCGCGACATTTTTCGA
AAGAATTTTTCCCTTATCTTCGTACACTCATAAATCAAGTTGGGAAGAGTAATAATAAGGGTGGTGGTGAAGAGT
TGACGAGAGCACTTGAGAGAGCGACGATTGCGTCTAATGGAAAATTGAAGGAGAAGCATGAATGGTTGCAGCCTG
CGGTGGATCAATGGCATCAAGAACAAAGAGGTGTGAAAGGAATACAACATATGAATGATTCTGTTCAAGTTGGTG
GGACTGGTGCGGATAGGATTAGAGGTGTGAAGAAGAAGAAGATGGTGATGTTTGGAAGTGGGATGGTTGCTGGAC
CTGCGGTTGAGGAGATTGCGAAAAGGGGGGATGTTGAACTTGTTATTGGTGAGAAGGTTATGCGCATATAATAGA
GATCATTATCTCATTTGTTGTTGTTGTGTAGCGACGAATTTACTGGGAGAGGCTCAGAAGCTTGCGATACGATAT
GGACAGGAACATAATAATATCAAGTATCGGATTGTGGATGTTGCGAAGAAGGAGACTTATGAGCATTTGGTTAAT
GAGGCGGATGTTGTCATCAGGTATGATTCCGTTTGATAAAGTAATGTTTTGAGGTATTATTAACGCATTGATGTA
GTTTGTTACCTGCGGCATATCATGTTGATATTGCGGAGATGTGTATTTCGGGAAAGAAACATCTCGTTACTGCAT
CTTACATCTCCGAACCCATGCGTCATCTCCATGATCGGTATGTTTATGTTTTTTTTTTTTTTTTCCTTTTTCTCC
TCCTCCTCCTCCTCACCTACTCATCTTTGTCTATATAATTAGAGCCTTATCAGCTGATGTGTTGCTGCTTAATGA
AATTGGACTTGATCCGGGGATAGATCATTGTTCAGCGATTTCGTTGATCAATGATTTGAAAGCAAAGGGAAAACA
AGTTGTTTCGTTTACGTCGTTTTGTGGAGGATTGCCTGCACCGGATTCGATATTCGATACGTCGTCGTCGTCGTC
GATGATGATGAAGAAGAGGGCGGTACCGTTGAAGTATAAATTTAGTTGGAGTCCTGTGGGTGTTTTGAGAGCTGC
GAATCAGGGGGTGAGGTATTTGCTAAATGACAAGGTGAATCTTTTGTCGTGATTTTGTTTTTTTTTTGTTGATTG
GTTGTAGGTTGTGAAACTTCCGGGGATGGAGTTACTTCGGTCTGGGTTTCCGAGGTTACCGATTTTGAGTGGGAA
GGAGGGTGATGGTGATGGCGTAGAGTTGGAGGGGATGCCGAATAGAGATAGTTTGCCGTATAGGGAGACTTATGG
ATTACGAGGTGAGGAGGGTGAGAGTTTGAGGACGTTGGTGCGAGGTACACTTCGGTGAGTTCAACACAAACGAAA
ATAACAACTTTTTTTTTTGGTTAATTGGTTGATTGGCGGTTGTTAGGTATCCGGGGTTTTGTTCTTTGATGCAGT
CGTTTAAGGATATTGGGTTGCTTGAAGATGGGAGGAAAATTCAAATTGGGGAGTGGAATGAGTTTTTGAGGCAAG
TGCTTGCTGTGAGACTTGGATCGTCATCGTCGTTGGGTTTGGATGGGAGTTTGGAAAGTGCTCTTAGGGATGTGC
AAGGGGTCGGAGAGAAGCAGTATGAGGAGACGATGGGTGCGTTGGAGTGGTTGGGTTTGTTGTCGAATTCGAATG
GAGGAGGAGGGAAGAAGATGATGGTTCCGATGAAGGAAGCTACGCCTTTAGAGTTGTTTGCTATGGTTTTGGGAA
ACAAGTTGAAGTATGGGCCGATGGAAAGGGATATGGTCGTACTCTCTCATGAAGTTATCGTTCGCAACAACCAAA
ACCAACAACAACCTCAACAAGAAGAAGTTCATCGATCGACTCTAGTCGCATATGGAGATGAATCCGCATCTGCTA
TGGCGAAAACGGTTGGTCTTCCTGTGGCGTTTGCAGCGCTAGATGTGTTGGATGGGAAAGTGGGGATGAGAGGGG
TGTGTGGACCGAATGAGAGGGAGATTTATGAGAGTGTTTTGGGGAGGTTGGAGGAGGTTGGGTTGGGGATGGTTG
AGAGTGTGGATTTGGTTGGGAGGGAGGGGTTGAGGACTGTAGAGGAGAGTTTGAGGGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail