Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|758100
Gene name
Locationscaffold_11:1200128..1201473
Strand+
Gene length (bp)1345
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.9E-14 105 237
PF00098 zf-CCHC Zinc knuckle 6.5E-04 294 310

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 101 404 5.0E-12

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|758100
MGPALGETTSETLQFPKFNGTNYHFWADNMKAALQAKSVWGVTSHRERCPPHPEAEYPGLYTTTSLTVEGELPTR
ARKVGQALIDVLQSKGYLAWEQSIEKYERWLNKDDMAMGLIRNAIEYTQRETIIDMNTSAEMWDHLHRTYVDQQS
GINIHFYYQELYSKKWDGHSSMSDHIGFYLNIRHRFIEAGHRIDNNVIINSLLLSLPHTPVWEVVKQNLLYNQSR
LTLKNVTAELLAVFDRILHEDDAKGSKSLALVSKGDNEASGSKKADGKEGKGKKKGKKKGKREPKPHDICHNCQE
KGHWSTTCTKPKKPKAESKAESKSAGNANVAVDNTSTSGTSREVGTLYMASKTMGIPTGLLLDSAATCHMICDCS
YFIEYEACTQQHISVGGFNNIPVAGVGKIRFRASSPNVLENYNDQVPRSGA*
Coding >Agabi119p4|758100
ATGGGCCCCGCACTTGGCGAAACGACTTCTGAGACTCTTCAGTTTCCGAAGTTTAACGGAACGAACTATCATTTT
TGGGCTGATAATATGAAGGCAGCCTTGCAGGCGAAATCCGTTTGGGGTGTTACTTCTCATCGCGAACGATGCCCA
CCTCATCCTGAGGCAGAGTATCCTGGTTTATACACCACTACTTCTCTGACTGTTGAAGGCGAACTTCCTACTCGA
GCCAGGAAGGTTGGCCAAGCTCTCATTGATGTCCTTCAGTCAAAGGGATATCTCGCTTGGGAACAAAGTATTGAG
AAGTATGAGAGGTGGTTGAACAAGGATGACATGGCAATGGGATTGATTCGGAATGCTATCGAGTACACTCAACGT
GAGACCATAATCGACATGAATACGTCCGCGGAGATGTGGGACCATCTTCACCGAACTTATGTTGATCAACAGAGT
GGAATAAATATCCACTTCTACTATCAGGAGCTATACTCGAAGAAGTGGGACGGTCATTCATCGATGAGTGATCAC
ATTGGGTTTTACCTCAATATCAGACATCGATTTATTGAAGCGGGTCATCGTATCGATAATAACGTTATCATCAAC
TCTCTCTTGTTGTCTCTTCCACATACGCCTGTCTGGGAAGTTGTTAAACAAAATCTTCTCTACAATCAAAGTCGG
CTTACTCTCAAAAATGTCACTGCGGAACTACTTGCAGTGTTTGATCGTATTCTTCATGAAGATGATGCTAAGGGT
TCCAAATCCCTAGCTCTTGTTTCAAAGGGGGATAACGAAGCGAGTGGGAGTAAGAAAGCTGATGGAAAAGAGGGT
AAAGGAAAGAAGAAGGGAAAGAAGAAAGGAAAACGTGAACCGAAACCTCACGATATTTGTCACAACTGTCAAGAA
AAGGGTCATTGGAGCACGACTTGTACTAAACCAAAGAAACCTAAAGCCGAGTCTAAAGCCGAGTCTAAATCCGCT
GGAAATGCAAACGTCGCTGTTGACAATACTAGTACTTCTGGAACTAGTCGTGAAGTTGGAACGCTATACATGGCT
TCCAAAACTATGGGAATTCCAACGGGACTACTCCTTGACAGTGCCGCTACTTGCCATATGATCTGTGATTGTTCA
TATTTTATCGAATACGAAGCTTGTACGCAACAGCATATTTCTGTTGGAGGTTTCAACAATATCCCTGTTGCTGGA
GTCGGAAAGATACGATTCCGTGCTTCATCTCCGAACGTCTTGGAAAACTACAACGATCAGGTGCCGAGATCAGGG
GCTTGA
Transcript >Agabi119p4|758100
ATGGGCCCCGCACTTGGCGAAACGACTTCTGAGACTCTTCAGTTTCCGAAGTTTAACGGAACGAACTATCATTTT
TGGGCTGATAATATGAAGGCAGCCTTGCAGGCGAAATCCGTTTGGGGTGTTACTTCTCATCGCGAACGATGCCCA
CCTCATCCTGAGGCAGAGTATCCTGGTTTATACACCACTACTTCTCTGACTGTTGAAGGCGAACTTCCTACTCGA
GCCAGGAAGGTTGGCCAAGCTCTCATTGATGTCCTTCAGTCAAAGGGATATCTCGCTTGGGAACAAAGTATTGAG
AAGTATGAGAGGTGGTTGAACAAGGATGACATGGCAATGGGATTGATTCGGAATGCTATCGAGTACACTCAACGT
GAGACCATAATCGACATGAATACGTCCGCGGAGATGTGGGACCATCTTCACCGAACTTATGTTGATCAACAGAGT
GGAATAAATATCCACTTCTACTATCAGGAGCTATACTCGAAGAAGTGGGACGGTCATTCATCGATGAGTGATCAC
ATTGGGTTTTACCTCAATATCAGACATCGATTTATTGAAGCGGGTCATCGTATCGATAATAACGTTATCATCAAC
TCTCTCTTGTTGTCTCTTCCACATACGCCTGTCTGGGAAGTTGTTAAACAAAATCTTCTCTACAATCAAAGTCGG
CTTACTCTCAAAAATGTCACTGCGGAACTACTTGCAGTGTTTGATCGTATTCTTCATGAAGATGATGCTAAGGGT
TCCAAATCCCTAGCTCTTGTTTCAAAGGGGGATAACGAAGCGAGTGGGAGTAAGAAAGCTGATGGAAAAGAGGGT
AAAGGAAAGAAGAAGGGAAAGAAGAAAGGAAAACGTGAACCGAAACCTCACGATATTTGTCACAACTGTCAAGAA
AAGGGTCATTGGAGCACGACTTGTACTAAACCAAAGAAACCTAAAGCCGAGTCTAAAGCCGAGTCTAAATCCGCT
GGAAATGCAAACGTCGCTGTTGACAATACTAGTACTTCTGGAACTAGTCGTGAAGTTGGAACGCTATACATGGCT
TCCAAAACTATGGGAATTCCAACGGGACTACTCCTTGACAGTGCCGCTACTTGCCATATGATCTGTGATTGTTCA
TATTTTATCGAATACGAAGCTTGTACGCAACAGCATATTTCTGTTGGAGGTTTCAACAATATCCCTGTTGCTGGA
GTCGGAAAGATACGATTCCGTGCTTCATCTCCGAACGTCTTGGAAAACTACAACGATCAGGTGCCGAGATCAGGG
GCTTGA
Gene >Agabi119p4|758100
ATGGGCCCCGCACTTGGCGAAACGACTTCTGAGACTCTTCAGTTTCCGAAGTTTAACGGAACGAACTATCATTTT
TGGGCTGATAATATGAAGGCAGCCTTGCAGGCGAAATCCGTTTGGGGTGTTACTTCTCATCGCGAACGATGCCCA
CCTCATCCTGAGGCAGAGTATCCTGGTTTATACACCACTACTTCTCTGACTGTTGAAGGCGAACTTCCTACTCGA
GCCAGGAAGGTTGGCCAAGCTCTCATTGATGTCCTTCAGTCAAAGGGATATCTCGCTTGGGAACAAAGTATTGAG
AAGTATGAGAGGTGGTTGAACAAGGATGACATGGCAATGGGATTGATTCGGAATGCTATCGAGTACACTCAACGT
GAGACCATAATCGACATGAATACGTCCGCGGAGATGTGGGACCATCTTCACCGAACTTATGTTGATCAACAGAGT
GGAATAAATATCCACTTCTACTATCAGGAGCTATACTCGAAGAAGTGGGACGGTCATTCATCGATGAGTGATCAC
ATTGGGTTTTACCTCAATATCAGACATCGATTTATTGAAGCGGGTCATCGTATCGATAATAACGTTATCATCAAC
TCTCTCTTGTTGTCTCTTCCACATACGCCTGTCTGGGAAGTTGTTAAACAAAATCTTCTCTACAATCAAAGTCGG
CTTACTCTCAAAAATGTCACTGCGGAACTACTTGCAGTGTTTGATCGTATTCTTCATGAAGATGATGCTAAGGGT
TCCAAATCCCTAGCTCTTGTTTCAAAGGGGGATAACGAAGCGAGTGGGAGTAAGAAAGCTGATGGAAAAGAGGGT
AAAGGAAAGAAGAAGGGAAAGAAGAAAGGAAAACGTGAACCGAAACCTCACGATATTTGTCACAACTGTCAAGAA
AAGGGTCATTGGAGCACGACTTGTACTAAACCAAAGAAACCTAAAGCCGAGTCTAAAGCCGAGTCTAAATCCGCT
GGAAATGCAAACGTCGCTGTTGACAATACTAGTACTTCTGGAACTAGTCGTGAAGTTGGAACGCTATACATGGCT
TCCAAAACTATGGGAATTCCAACGGGACTACTCCTTGACAGTGCCGCTACTTGCCATATGATCTGTGATTGTTCA
TATTTTATCGAATACGAAGCTTGTACGCAACAGCATATTTCTGTTGGAGGTTTCAACAATATCCCTGTTGCTGGA
GTCGGAAAGATACGATTCCGTGCTTCATCTCCGAACGGTCATAACGACATCACGCTCGATGATGCTCTTTATATT
CCTAACTTGGGAGCGAATCTCATTAGTCTTGGAAAACTACAACGATCAGGTGCCGAGATCAGGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail