Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|753050
Gene name
Locationscaffold_11:850380..851754
Strand+
Gene length (bp)1374
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01753 zf-MYND MYND finger 3.1E-08 145 181

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 130 181 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|753050
MALNLRDKELFPTFGQLPSDTPDDGYDVDYFEFDEYLGVIEPIHHWCLLVEITEVVPYIRPTYYGKDVDGTAVFI
VFYTDDRSPQIARNCNVGNTLALMYAETHMFNDGQVGIRVDSDDYVKLFHSTLQGVFQIDELLNSKMTSCHLCDK
PAKSQCINCQVKYCSKDCQVADWKPRHKDECRKSVKVDTPLLIDRIQASLRTLKYHHQSKFPDDPRRPSNDTPQE
DIWYKWVLLAAPATMLDARTRAGEKLFPNHSISFDARFKLPQGKISDGRSLYLGSGLRFIDTLRPNVGASCLKAS
TFTSKLGKLAIPSDVPPHTCSSRSKLRT*
Coding >Agabi119p4|753050
ATGGCTCTTAACCTCAGAGACAAGGAACTGTTCCCGACCTTTGGGCAGCTACCTTCCGACACACCCGACGATGGC
TACGACGTTGACTACTTCGAATTCGACGAATATTTGGGTGTCATAGAGCCCATTCACCACTGGTGCCTCCTCGTA
GAAATCACCGAAGTCGTCCCCTACATTCGCCCCACGTACTATGGCAAGGACGTAGATGGAACTGCTGTATTCATC
GTTTTCTACACCGACGATCGTTCCCCTCAGATCGCGCGCAACTGCAATGTGGGGAATACGTTAGCACTCATGTAC
GCCGAAACACACATGTTCAATGACGGACAGGTGGGCATTCGAGTCGACTCGGATGACTATGTCAAGCTGTTCCAT
TCTACACTGCAAGGTGTCTTTCAAATTGACGAGTTGCTCAACTCAAAGATGACGTCTTGTCACCTTTGCGACAAA
CCAGCGAAATCTCAGTGCATAAACTGCCAAGTCAAATATTGCAGCAAGGACTGTCAGGTCGCCGATTGGAAACCC
AGGCACAAGGATGAATGCAGAAAGTCTGTAAAAGTCGATACTCCCCTTTTAATCGATCGCATTCAAGCCTCGTTA
CGAACCCTCAAATACCATCATCAGAGCAAGTTCCCCGATGATCCTCGCAGACCTTCCAATGATACACCGCAGGAA
GACATATGGTACAAATGGGTTTTATTAGCCGCTCCTGCCACGATGCTCGATGCACGAACCCGAGCCGGGGAAAAG
CTCTTTCCCAACCACTCAATATCATTCGATGCGAGATTTAAACTTCCGCAAGGTAAAATTTCGGATGGAAGGAGT
CTGTATCTGGGCTCGGGTCTCAGATTCATTGACACGCTCCGACCGAATGTCGGCGCCTCGTGCCTCAAGGCCTCA
ACGTTTACAAGCAAGTTGGGCAAACTGGCTATCCCATCAGATGTGCCGCCACATACTTGCTCTTCTCGCTCCAAA
CTTCGAACCTGA
Transcript >Agabi119p4|753050
ATGGCTCTTAACCTCAGAGACAAGGAACTGTTCCCGACCTTTGGGCAGCTACCTTCCGACACACCCGACGATGGC
TACGACGTTGACTACTTCGAATTCGACGAATATTTGGGTGTCATAGAGCCCATTCACCACTGGTGCCTCCTCGTA
GAAATCACCGAAGTCGTCCCCTACATTCGCCCCACGTACTATGGCAAGGACGTAGATGGAACTGCTGTATTCATC
GTTTTCTACACCGACGATCGTTCCCCTCAGATCGCGCGCAACTGCAATGTGGGGAATACGTTAGCACTCATGTAC
GCCGAAACACACATGTTCAATGACGGACAGGTGGGCATTCGAGTCGACTCGGATGACTATGTCAAGCTGTTCCAT
TCTACACTGCAAGGTGTCTTTCAAATTGACGAGTTGCTCAACTCAAAGATGACGTCTTGTCACCTTTGCGACAAA
CCAGCGAAATCTCAGTGCATAAACTGCCAAGTCAAATATTGCAGCAAGGACTGTCAGGTCGCCGATTGGAAACCC
AGGCACAAGGATGAATGCAGAAAGTCTGTAAAAGTCGATACTCCCCTTTTAATCGATCGCATTCAAGCCTCGTTA
CGAACCCTCAAATACCATCATCAGAGCAAGTTCCCCGATGATCCTCGCAGACCTTCCAATGATACACCGCAGGAA
GACATATGGTACAAATGGGTTTTATTAGCCGCTCCTGCCACGATGCTCGATGCACGAACCCGAGCCGGGGAAAAG
CTCTTTCCCAACCACTCAATATCATTCGATGCGAGATTTAAACTTCCGCAAGGTAAAATTTCGGATGGAAGGAGT
CTGTATCTGGGCTCGGGTCTCAGATTCATTGACACGCTCCGACCGAATGTCGGCGCCTCGTGCCTCAAGGCCTCA
ACGTTTACAAGCAAGTTGGGCAAACTGGCTATCCCATCAGATGTGCCGCCACATACTTGCTCTTCTCGCTCCAAA
CTTCGAACCTGA
Gene >Agabi119p4|753050
ATGGCTCTTAACCTCAGAGACAAGGTAGACCACTTTTCTGACTAGACGCGTATCCCTACTGAGCCATGATAGGAA
CTGTTCCCGACCTTTGGGCAGCTACCTTCCGACACACCCGACGATGGCTACGACGTTGACTACTTCGAATTCGAC
GAATATTTGGGTGTCATAGAGCCCATTCACCACTGGTGCCTCCTCGTAGAAATCACCGAAGTCGTCCCCTACATT
CGCCCCACGTACTATGGCAAGGACGTAGATGGAACTGCTGTATTCATCGTTTTCTACACCGACGATCGTTCCCCT
CAGATCGCGCGCAACTGCAATGTGGGGAATACGTTAGCACTCATGTACGCCGAAACACACATGTTCAATGACGGA
CAGGTGGGCATTCGAGTCGACTCGGATGACTATGTCAAGGTGTGCCATCTCATTCCATTACCGCGACTTCAAAAT
ATAACTACGTTTTTAGCTGTTCCATTCTACACTGCAAGGTGTCTTTCAAATTGACGAGTTGCTCAACTCAAAGAT
GACGTCTTGTCACCTTTGCGACAAACCAGCGAAATCTCAGTGCATAAACTGCCAAGTCAAATATTGCAGCAAGGT
ATATATATATACCATACTTTCTTACTCGCCACTTACCTTTTGTCGATGTAGGACTGTCAGGTCGCCGATTGGAAA
CCCAGGCACAAGGATGAATGCAGAGTAGGAAAATGCATCAAACAGTGGAAGTCCTTCAATTGGTGGGACTTTGAC
GATTATAGAAGTCTGTAAAAGGTGCAACTTTACTCCAGCTTTTTTAATTTTTCGAGCCATGGCATGACTACGGTT
AATACTAGTCGATACTCCCCTTTTAATCGATCGCATTCAAGCCTCGTTACGAACCCTCAGTATGCCGGACGCTAT
AAATCAGCCCAGGTTGACATTACGCTATTCTTAGAATACCATCATCAGAGCAAGTTCCCCGATGATGTAACTTGA
CCCCCACCTTCACGAGTCCATACATTTCACTGTGCCCACCCTGAGTGTCCCCAGCCTCGCAGACCTTCCAATGAT
ACACCGCAGGAAGACATATGGTACAAATGGGTTTTATTAGCCGCTCCTGCCACGATGCTCGATGCACGAACCCGA
GCCGGGGAAAAGCTCTTTCCCAACCACTCAATATCATTCGATGCGAGATTTAAACTTCCGCAAGGTAAAATTTCG
GATGGAAGGAGTCTGTATCTGGGCTCGGGTCTCAGATTCATTGACACGCTCCGACCGAATGTCGGCGCCTCGTGC
CTCAAGGCCTCAACGTTTACAAGCAAGTTGGGCAAACTGGCTATCCCATCAGATGTGCCGCCACATACTTGCTCT
TCTCGCTCCAAACTTCGAACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail