Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|752700
Gene name
Locationscaffold_11:814145..815227
Strand-
Gene length (bp)1082
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02182 SAD_SRA SAD/SRA domain 3.6E-51 54 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 6 210 1.0E-29
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 51 212 4.0E-29
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 52 212 7.0E-29
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 52 206 1.0E-28
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 52 206 8.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 6 210 1.0E-29
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 51 212 4.0E-29
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 52 212 7.0E-29
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 52 206 1.0E-28
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 52 206 8.0E-28
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 60 212 2.0E-27
sp|B6CHA3|UHRF1_XENLA E3 ubiquitin-protein ligase UHRF1 OS=Xenopus laevis GN=uhrf1 PE=2 SV=1 52 206 2.0E-27
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 60 212 2.0E-27
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 52 212 9.0E-27
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 60 212 8.0E-25
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 6 212 5.0E-24
sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 60 212 5.0E-24
sp|Q96PU4|UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens GN=UHRF2 PE=1 SV=1 6 212 1.0E-22
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 56 213 6.0E-22
sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 60 212 1.0E-20
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 8 210 2.0E-20
sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 60 212 6.0E-19
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 7 212 2.0E-17
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 48 213 3.0E-17
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 56 212 1.0E-16
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 9 210 1.0E-14
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 56 213 2.0E-14
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 56 213 3.0E-14
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 48 208 5.0E-14
sp|Q9C5P0|SUVH8_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH8 OS=Arabidopsis thaliana GN=SUVH8 PE=3 SV=1 7 219 9.0E-11
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 7 219 1.0E-10
sp|Q9FHI0|YDG1_ARATH YDG domain-containing protein At5g47150 OS=Arabidopsis thaliana GN=At5g47150 PE=2 SV=1 7 213 2.0E-09
sp|Q3EC60|SUVHA_ARATH Putative inactive histone-lysine N-methyltransferase family member SUVH10 OS=Arabidopsis thaliana GN=SUVH10 PE=3 SV=1 98 212 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|752700
MSSGPGQRFSLIRREIKASRGGSDATRRSESAATRQGFLTIGPKKRPPREGYYGPPKCPVGTMFASRKECSEAGV
HFPLVAGISGSTSSTRRDANPGAFSIVLSGGYEDDVDDGNTILYTGAGGQTNTFSKTNSQVENQDIKHHFNHALR
LNLYSGNPVRVVRGFKSESRWAPSEGYRYDGLYKVAGAKIKLGKSGHQVCLFRLERLPDQQPLEELQSHLP*
Coding >Agabi119p4|752700
ATGAGTTCGGGACCAGGGCAAAGGTTTTCACTCATCCGTAGGGAGATAAAGGCATCCAGAGGTGGCAGCGACGCC
ACGAGACGGTCTGAAAGCGCAGCCACTCGTCAAGGATTCTTGACTATAGGGCCAAAAAAGCGCCCCCCCAGAGAG
GGATACTATGGACCTCCAAAGTGCCCAGTTGGGACCATGTTTGCCTCAAGAAAAGAGTGCTCGGAGGCGGGAGTC
CACTTCCCATTGGTAGCCGGAATATCTGGTTCAACAAGTTCTACGAGGCGGGACGCTAACCCGGGAGCCTTCTCC
ATTGTTCTCAGTGGTGGTTATGAAGATGACGTTGATGATGGAAATACTATTCTTTACACTGGAGCCGGGGGCCAA
ACAAATACTTTTAGCAAGACAAATTCACAAGTTGAAAACCAGGACATCAAGCATCACTTCAATCATGCTCTTCGT
TTGAATCTATATTCGGGCAATCCAGTCCGAGTTGTGCGAGGTTTCAAGAGTGAGTCCAGGTGGGCACCTAGTGAA
GGCTACCGTTACGACGGCCTTTATAAAGTTGCCGGGGCCAAGATAAAATTGGGAAAGAGTGGGCATCAAGTCTGC
CTATTTCGGCTGGAGCGTCTTCCCGACCAACAGCCCCTAGAAGAGTTGCAGAGCCATCTGCCGTAA
Transcript >Agabi119p4|752700
ATGAGTTCGGGACCAGGGCAAAGGTTTTCACTCATCCGTAGGGAGATAAAGGCATCCAGAGGTGGCAGCGACGCC
ACGAGACGGTCTGAAAGCGCAGCCACTCGTCAAGGATTCTTGACTATAGGGCCAAAAAAGCGCCCCCCCAGAGAG
GGATACTATGGACCTCCAAAGTGCCCAGTTGGGACCATGTTTGCCTCAAGAAAAGAGTGCTCGGAGGCGGGAGTC
CACTTCCCATTGGTAGCCGGAATATCTGGTTCAACAAGTTCTACGAGGCGGGACGCTAACCCGGGAGCCTTCTCC
ATTGTTCTCAGTGGTGGTTATGAAGATGACGTTGATGATGGAAATACTATTCTTTACACTGGAGCCGGGGGCCAA
ACAAATACTTTTAGCAAGACAAATTCACAAGTTGAAAACCAGGACATCAAGCATCACTTCAATCATGCTCTTCGT
TTGAATCTATATTCGGGCAATCCAGTCCGAGTTGTGCGAGGTTTCAAGAGTGAGTCCAGGTGGGCACCTAGTGAA
GGCTACCGTTACGACGGCCTTTATAAAGTTGCCGGGGCCAAGATAAAATTGGGAAAGAGTGGGCATCAAGTCTGC
CTATTTCGGCTGGAGCGTCTTCCCGACCAACAGCCCCTAGAAGAGTTGCAGAGCCATCTGCCGTAA
Gene >Agabi119p4|752700
ATGAGTTCGGGACCAGGGCAAAGGTTTTCACTCATCCGTAGGGAGATAAAGGCATCCAGAGGTGGCAGCGACGCC
ACGAGACGGTCTGAAAGCGCAGCCACTCGTCAAGGATTCTTGACTATAGGGCCAAAAAAGCGCCCCCCCAGAGAG
GGATACTATGGACCTCCAAAGTGCCCAGTTGGGACCATGTTTGCCTCAAGGTTTGCTGATAGGCTAGCCTGAATG
TAATTAAGCTTATAGTATACTAGAAAAGAGTGCTCGGAGGCGGGAGTCCACTTCCCATTGGTAGCCGGAATATCT
GGTTCAACAAGTTCTACGAGGCGGGACGCTAACCCGGGAGCCTTCTCCATTGTTCTCAGTGGTGGTTATGAAGAT
GACGTTGATGATGGAAATACTATGTGAGTTTGCTTTATATACTTGAATGCCAACTGAGTTGAACTGACAATGATG
GATATGACAGTCTTTACACTGGAGCCGGTATGTATTTAGCTGATGAGCCTTATCCAAGTTCATATCTACATACTG
CATACAGGGGGCCAAACAAATACTTTTAGCAAGGTGTGGGTTCAAACGATGCTGAATCTCAGTATTTCTGACTAG
TCAAAGACAAATTCACAAGTTGAAAACCAGGACATCAAGCATCACTTCAATCATGCTCTTCGTGTATGATACAGT
TTCTTCTTTGTCTCAACCCTCTCACATGGTCCGATAGTTGAATCTATATTCGGGCAATCCAGTCCGAGTTGTGCG
AGGTTTCAAGAGTGAGTCCAGGTGGGCACCTAGTGAAGGGTAAGTTAGAACGCTCATCCTTATACAGAAACTGAT
TTACTCCACTAGCTACCGTTACGACGGCCTTTATAAAGTTGCCGGGGTACGTACCGTCTTGTCTGTGTTTCTTGA
AAATGGACTTAATGATTGGGATCAGGCCAAGATAAAATTGGGAAAGAGTGGGCATCAAGTCTGCCTATTTCGGCT
GGAGGTTCGTGCTCTCTATTGTCAAAGCCTGGGTGGCTTGCTAACCCGGGTGATAGCGTCTTCCCGACCAACAGC
CCCTAGAAGAGTTGCAGAGCCATCTGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail