Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|749500
Gene name
Locationscaffold_11:416321..417148
Strand+
Gene length (bp)827
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 8.4E-10 153 243

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|749500
MPSNPPTATTTTVVDNSSNDDNHSAIYPVLDFNKTPLPEYNGHYCKIIDKLFSPSECADLLALAESHTPWSQAAV
HYGLGPTQNYVNLEYRNSERILLFDFDAASRIYNKLLPHITEVVELASGIPYSKEIVGGSQLKGFKYKLIGLNER
LSYLKYGPGNYFRRHCDGRLELPDLRRSFITIQIYLGDDIDLQGGATRFSSNRSNNSESYIDVDPKLGRVLIFQQ
RSLTHSGEEVTKGIKYALRSDLMFTREPVS*
Coding >Agabi119p4|749500
ATGCCGTCCAATCCCCCCACCGCCACAACAACCACTGTCGTCGACAATAGTAGTAACGACGACAACCACAGTGCC
ATCTATCCTGTTCTCGACTTCAACAAGACTCCTCTTCCTGAATATAACGGCCACTATTGCAAAATTATCGACAAG
CTTTTCTCACCTTCCGAATGCGCCGATCTTCTTGCCCTAGCTGAGTCCCACACCCCATGGTCTCAAGCCGCTGTA
CATTACGGGTTAGGTCCCACACAAAACTACGTCAACCTTGAATACCGTAACTCTGAGCGGATCTTGCTCTTTGAC
TTTGACGCCGCCTCACGAATATACAATAAACTCTTGCCCCACATCACCGAAGTCGTAGAGCTTGCTTCCGGAATC
CCTTATAGTAAAGAAATAGTGGGCGGATCCCAATTGAAAGGCTTCAAATACAAACTTATTGGCCTTAACGAACGC
CTCAGTTATCTCAAGTATGGCCCCGGAAATTATTTTCGCCGTCACTGTGACGGTAGACTTGAACTTCCAGACCTT
CGACGATCGTTCATCACAATCCAGATATACCTGGGAGACGACATTGATCTCCAAGGAGGCGCTACAAGATTTTCG
TCAAATCGTTCAAATAACTCAGAGAGCTATATCGACGTCGACCCTAAATTGGGTCGCGTACTCATATTCCAACAA
CGAAGCTTGACACACAGTGGCGAAGAGGTGACCAAAGGTATCAAATATGCCCTGAGATCGGATTTGATGTTTACT
CGGGAACCCGTAAGCTGA
Transcript >Agabi119p4|749500
ATGCCGTCCAATCCCCCCACCGCCACAACAACCACTGTCGTCGACAATAGTAGTAACGACGACAACCACAGTGCC
ATCTATCCTGTTCTCGACTTCAACAAGACTCCTCTTCCTGAATATAACGGCCACTATTGCAAAATTATCGACAAG
CTTTTCTCACCTTCCGAATGCGCCGATCTTCTTGCCCTAGCTGAGTCCCACACCCCATGGTCTCAAGCCGCTGTA
CATTACGGGTTAGGTCCCACACAAAACTACGTCAACCTTGAATACCGTAACTCTGAGCGGATCTTGCTCTTTGAC
TTTGACGCCGCCTCACGAATATACAATAAACTCTTGCCCCACATCACCGAAGTCGTAGAGCTTGCTTCCGGAATC
CCTTATAGTAAAGAAATAGTGGGCGGATCCCAATTGAAAGGCTTCAAATACAAACTTATTGGCCTTAACGAACGC
CTCAGTTATCTCAAGTATGGCCCCGGAAATTATTTTCGCCGTCACTGTGACGGTAGACTTGAACTTCCAGACCTT
CGACGATCGTTCATCACAATCCAGATATACCTGGGAGACGACATTGATCTCCAAGGAGGCGCTACAAGATTTTCG
TCAAATCGTTCAAATAACTCAGAGAGCTATATCGACGTCGACCCTAAATTGGGTCGCGTACTCATATTCCAACAA
CGAAGCTTGACACACAGTGGCGAAGAGGTGACCAAAGGTATCAAATATGCCCTGAGATCGGATTTGATGTTTACT
CGGGAACCCGTAAGCTGA
Gene >Agabi119p4|749500
ATGCCGTCCAATCCCCCCACCGCCACAACAACCACTGTCGTCGACAATAGTAGTAACGACGACAACCACAGTGCC
ATCTATCCTGTTCTCGACTTCAACAAGACTCCTCTTCCTGAATATAACGGCCACTATTGCAAAATTATCGACAAG
CTTTTCTCACCTTCCGAATGCGCCGATCTTCTTGCCCTAGCTGAGTCCCACACCCCATGGTCTCAAGCCGCTGTA
CATTACGGGTTAGGTCCCACACAAAACTACGTCAACCTTGAATACCGTAACTCTGAGCGGATCTTGCTCTTTGAC
TTTGACGCCGCCTCACGAATATACAATAAACTCTTGCCCCACATCACCGAAGTCGTAGAGCTTGCTTCCGGAATC
CCTTATAGTAAAGAAATAGTGGGCGGATCCCAATTGAAAGGCTTCAAATACAAACTTATTGGGTATGTTAGCTAT
GATCCGAGTCTAACTCATTGACACGATATCATTTCTTTTTGTACAGCCTTAACGAACGCCTCAGTTATCTCAAGT
ATGGCCCCGGAAATTATTTTCGCCGTCACTGTGACGGTAGACTTGAACTTCCAGACCTTCGACGATCGTTCATCA
CAATCCAGATATACCTGGGAGACGACATTGATCTCCAAGGAGGCGCTACAAGATTTTCGTCAAATCGTTCAAATA
ACTCAGAGAGCTATATCGACGTCGACCCTAAATTGGGTCGCGTACTCATATTCCAACAACGAAGCTTGACACACA
GTGGCGAAGAGGTGACCAAAGGTATCAAATATGCCCTGAGATCGGATTTGATGTTTACTCGGGAACCCGTAAGCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail