Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|749250
Gene name
Locationscaffold_11:367527..368919
Strand-
Gene length (bp)1392
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 4.5E-10 71 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4V1|PMU1_ARTBC Probable phosphoglycerate mutase ARB_03491 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03491 PE=1 SV=1 3 280 3.0E-58
sp|Q5ACP5|PGA12_CANAL Phosphomutase-like protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA12 PE=1 SV=1 66 279 2.0E-40
sp|P36069|PMU1_YEAST Probable phosphoglycerate mutase PMU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMU1 PE=1 SV=1 9 265 5.0E-28
sp|Q9FGF0|PGML1_ARATH Phosphoglycerate mutase-like protein 1 OS=Arabidopsis thaliana GN=At5g64460 PE=2 SV=1 65 284 1.0E-17
sp|Q8GY96|PGM_ARATH Phosphoglycerate mutase-like protein OS=Arabidopsis thaliana GN=PGM PE=2 SV=1 65 264 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4V1|PMU1_ARTBC Probable phosphoglycerate mutase ARB_03491 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03491 PE=1 SV=1 3 280 3.0E-58
sp|Q5ACP5|PGA12_CANAL Phosphomutase-like protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA12 PE=1 SV=1 66 279 2.0E-40
sp|P36069|PMU1_YEAST Probable phosphoglycerate mutase PMU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMU1 PE=1 SV=1 9 265 5.0E-28
sp|Q9FGF0|PGML1_ARATH Phosphoglycerate mutase-like protein 1 OS=Arabidopsis thaliana GN=At5g64460 PE=2 SV=1 65 284 1.0E-17
sp|Q8GY96|PGM_ARATH Phosphoglycerate mutase-like protein OS=Arabidopsis thaliana GN=PGM PE=2 SV=1 65 264 3.0E-13
sp|F4IBB2|PGML2_ARATH Phosphoglycerate mutase-like protein 2 OS=Arabidopsis thaliana GN=At1g58280 PE=2 SV=1 65 284 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|749250
MSTPIYNYQAIPGFFAHDTEDHQSLTLPPIPPRLGLLDDSSDRWRNFRKRITELDEEARKENGSVKVFFFARHGQ
GWHNVAEAKYGTKHWDAEMSIKNGDDDIIWGPDPELTPIGINQAMEARRGWEEELAFGITLPDKLYSSPLVRAMD
TLRVTFEGIFRGDTEKQPTVLVVENCREENGIHTCDQRRSRSFIHERFPTFEFEEGLTEEDELWDAEIRETKAQV
SKRAQDVLDYIFQKDTDSTYISVTAHGGIINGFLQAIGRPSFPLLTGGILPVVIKCRRR*
Coding >Agabi119p4|749250
ATGAGCACCCCTATCTACAACTATCAGGCTATACCTGGTTTTTTTGCACATGATACAGAAGATCATCAATCTTTG
ACTTTACCACCAATTCCGCCTAGATTGGGTTTACTTGATGATTCTTCGGACCGGTGGCGGAATTTTCGAAAGAGG
ATCACAGAGCTTGATGAAGAGGCGAGGAAAGAGAATGGGAGTGTCAAAGTGTTCTTTTTCGCTAGGCATGGTCAG
GGTTGGCATAATGTGGCCGAAGCAAAGTACGGAACGAAGCACTGGGATGCAGAGATGAGTATAAAGAATGGAGAT
GATGATATCATTTGGGGACCGGATCCGGAACTTACGCCGATCGGAATCAATCAGGCTATGGAAGCTAGACGAGGG
TGGGAGGAAGAGCTTGCATTTGGAATTACACTCCCCGACAAGTTGTATTCGAGTCCATTGGTGAGGGCAATGGAT
ACACTGAGGGTAACTTTCGAAGGGATATTTCGGGGTGATACCGAAAAACAGCCGACTGTTCTTGTCGTCGAGAAT
TGTCGCGAAGAAAATGGAATACATACTTGTGACCAACGCAGATCACGATCATTTATCCATGAACGGTTTCCTACC
TTTGAATTTGAGGAAGGACTTACTGAAGAAGATGAATTGTGGGATGCGGAGATCAGAGAAACAAAAGCTCAAGTT
TCAAAGCGGGCGCAGGACGTCTTGGATTATATATTTCAAAAGGATACAGACTCGACTTATATTTCTGTTACTGCA
CATGGTGGTATCATCAATGGATTCCTTCAAGCCATCGGTCGCCCTTCTTTCCCGCTGTTGACTGGAGGAATTCTT
CCTGTCGTGATCAAGTGCCGGAGAAGATAG
Transcript >Agabi119p4|749250
ATGAGCACCCCTATCTACAACTATCAGGCTATACCTGGTTTTTTTGCACATGATACAGAAGATCATCAATCTTTG
ACTTTACCACCAATTCCGCCTAGATTGGGTTTACTTGATGATTCTTCGGACCGGTGGCGGAATTTTCGAAAGAGG
ATCACAGAGCTTGATGAAGAGGCGAGGAAAGAGAATGGGAGTGTCAAAGTGTTCTTTTTCGCTAGGCATGGTCAG
GGTTGGCATAATGTGGCCGAAGCAAAGTACGGAACGAAGCACTGGGATGCAGAGATGAGTATAAAGAATGGAGAT
GATGATATCATTTGGGGACCGGATCCGGAACTTACGCCGATCGGAATCAATCAGGCTATGGAAGCTAGACGAGGG
TGGGAGGAAGAGCTTGCATTTGGAATTACACTCCCCGACAAGTTGTATTCGAGTCCATTGGTGAGGGCAATGGAT
ACACTGAGGGTAACTTTCGAAGGGATATTTCGGGGTGATACCGAAAAACAGCCGACTGTTCTTGTCGTCGAGAAT
TGTCGCGAAGAAAATGGAATACATACTTGTGACCAACGCAGATCACGATCATTTATCCATGAACGGTTTCCTACC
TTTGAATTTGAGGAAGGACTTACTGAAGAAGATGAATTGTGGGATGCGGAGATCAGAGAAACAAAAGCTCAAGTT
TCAAAGCGGGCGCAGGACGTCTTGGATTATATATTTCAAAAGGATACAGACTCGACTTATATTTCTGTTACTGCA
CATGGTGGTATCATCAATGGATTCCTTCAAGCCATCGGTCGCCCTTCTTTCCCGCTGTTGACTGGAGGAATTCTT
CCTGTCGTGATCAAGTGCCGGAGAAGATAG
Gene >Agabi119p4|749250
ATGAGCACCCCTATCTACAACTATCAGGTATGCTCACGATCATCTCGTATTCTTCGATTTCTTGCGCTTATGAGG
TTTGGTTTTGGTGTTTAGGCTATACCTGGTTTTTTTGCACATGATACAGAAGATCATCAATCTTTGACTTTACCA
CCAGTAAGTACCTCCTACACGAAAGTATACGACTCGAGTGATAGAGATTTCATTTGCTGAGCATTCGTGTTATCC
AGATTCCGCCTAGATTGGGTTTACTTGATGATTCTTCGGACCGGTGGCGGAATTTTCGAAAGAGGATCACAGAGC
TTGATGAAGAGGCGAGGAAAGAGAATGGGAGTGTCAAAGTGTTCTTTTTCGCTAGGCATGGTCAGGGTTGGCGTG
CGTAATCATCATCTTTTCTCCGGTGGTTGAACTTATGTGAGCTCATCGTGGTCAAAATAGATAATGTGGCCGAAG
CAAAGTACGGAACGAAGCACTGGGATGCGTATGTGATTCTTCCCTTTTTGTTTTTGAATTTAATGAAAGGCCTTT
ATAGAGAGATGAGTATAAAGAATGGAGATGATGATATCATTTGGGGACGTGAGTAGATTCCGCACCAGCTTGTCT
CCTTCTTCTACTCGGACATTGAACATTGAAACGAGGGTTTGTTGTTGTTTTCCCTGTCCGTTTTTCTACAAAAAT
ATAGCGGATCCGGAACTTACGCCGATCGGAATCAATCAGGCTATGGAAGCTAGACGAGGGTGGGAGGAAGAGCTT
GCATTTGGAATTACACTCCCCGACAAGTTGTATTCGAGTCCATTGGTGAGGGCAATGGATACACTGAGGGTAACT
TTCGAAGGGATATTTCGGGGTGATACCGAAAAACAGCCGACTGTTCTTGTCGTCGAGGTGAGCGGTCCTTGTGTA
GCCTGAAATGTTTCTGTGATTTTTGATGACTTTCCCCAGAATTGTCGCGAAGAAAATGGAATACATACTTGTGAC
CAACGCAGATCACGATCATTTATCCATGAACGGTTTCCTACCTTTGAATTTGAGGAAGGACTTACTGAAGAAGAT
GAATTGTGGGATGCGGAGATCAGAGAAACAAAAGCTCAAGTTTCAAAGCGGGCGCAGGACGTCTTGGATTATATA
TTTCAAAAGGATACAGACTCGACTTGTATGTGTCCGACTTCGCAAAGATACACTCATTCTTATGTGTGTTGTAGA
TATTTCTGTTACTGCACATGGTGGTATCATCAATGGATTCCTTCAAGCCATCGGTCGCCCTTCTTTCCCGCTGTT
GACTGGAGGTATGTTAGCACCGTGGCTAGTATTTGATCTTTCCAGCTGCACGTTAAGCGATGTCGTTTTTTTTTA
TTAGGAATTCTTCCTGTCGTGATCAAGTGCCGGAGAAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail