Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|748850
Gene name
Locationscaffold_11:346980..348881
Strand-
Gene length (bp)1901
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17921 Integrase_H2C2 Integrase zinc binding domain 2.1E-09 236 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 295 535 2.0E-09
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 227 544 5.0E-08
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 227 544 5.0E-08
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 296 435 2.0E-07
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 296 435 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 295 535 2.0E-09
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 227 544 5.0E-08
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 227 544 5.0E-08
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 296 435 2.0E-07
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 296 435 2.0E-07
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 296 435 2.0E-07
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 296 466 2.0E-07
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 296 435 2.0E-07
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 296 435 4.0E-07
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 296 435 4.0E-07
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 296 435 4.0E-07
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 296 435 9.0E-07
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 296 435 2.0E-06
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 296 435 2.0E-06
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 294 463 3.0E-06
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 306 430 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|748850
MLNNPGKLPNATVNRWVDYIRTHFHFTLLHKKGKSFGPDGLSRRKWYPGDPLARRFDDGSEDGEEDFELVKENPD
DEDPLPLEAFVDEIDNRTGYLQQIINDTPVYQLARVATEQEIQQRARLATSDNCLATYKVFLGQVATLEQSALEA
SEDDQISPYDEDRRTLEAKRQDAQLPAIREWLANDPKNVDLHKMSPAKARFVRAASHFWLDKEGRLFRKIAGAGF
PQLVVEIEDHMRIMRECHDKLGHRGAYATSKLIAQRFWWPEVDGDVACYPYPFYISSVACGYCSYDSTFNGCKYI
VHGRCALSSWMEARALRKEDAKAIGTWIFEDIICRWGSLVKIVTDNGSAFRKAVKWLEEKYGIKGVAISPYNSQA
NGVIERPHWDVRQMLYKATAGDVKKWFWHLHHVAWADRITVRKGTGCSPYFMITGAHPTLPLDIIEATWLVKFPE
TLVSTADLIGLRAQALAKHVTHVEQMRQRVNDEKLRRALQLEQTMQHKIKEFNLKSGDLALVRNSAIEMSADRKM
KSRYLGPVVIVKRLKGGAYIVCEYDGSVWQNKVAAFRVVPYLARQKITLSDKVQQLLDADIEELQLLEETTVDSD
TGNVSEHEDNA*
Coding >Agabi119p4|748850
ATGTTAAACAATCCTGGAAAGCTACCAAATGCAACGGTGAATCGCTGGGTGGACTACATCAGAACTCACTTCCAT
TTTACGCTTCTACACAAGAAAGGAAAAAGCTTTGGGCCAGACGGCCTATCGCGACGTAAATGGTACCCAGGGGAT
CCCTTAGCTAGACGATTCGATGATGGCTCCGAGGACGGAGAAGAGGACTTCGAACTAGTCAAGGAAAACCCTGAC
GACGAAGATCCTCTACCTCTTGAAGCTTTTGTCGACGAAATCGATAATCGAACAGGTTACCTTCAGCAGATAATA
AATGATACTCCGGTCTATCAACTGGCAAGAGTAGCTACAGAACAAGAAATACAGCAGCGAGCTCGACTAGCTACT
AGCGATAATTGTCTAGCTACATACAAAGTATTCTTAGGACAAGTGGCAACGCTAGAACAGTCAGCTTTAGAAGCA
TCAGAAGATGATCAGATCAGTCCCTACGATGAGGATAGACGCACCCTTGAAGCAAAGCGTCAAGATGCACAGCTA
CCAGCAATCAGAGAATGGCTAGCTAACGACCCAAAGAACGTGGACCTCCATAAAATGAGTCCAGCTAAAGCTCGT
TTTGTGAGAGCAGCTTCCCACTTCTGGCTAGATAAGGAAGGGAGACTCTTTCGAAAGATTGCAGGAGCCGGATTT
CCTCAGCTAGTGGTCGAAATAGAAGATCACATGAGAATAATGCGAGAATGCCATGATAAGCTAGGACATCGAGGC
GCTTATGCAACTAGTAAACTAATAGCTCAGCGCTTCTGGTGGCCAGAAGTAGATGGAGATGTAGCTTGTTACCCA
TACCCCTTCTATATTTCAAGTGTTGCATGCGGATACTGTTCATATGACTCCACCTTCAACGGATGTAAATACATT
GTTCATGGAAGGTGTGCGTTGTCATCTTGGATGGAAGCTAGAGCACTTAGGAAGGAAGATGCTAAAGCTATTGGA
ACTTGGATCTTCGAAGACATTATATGTCGATGGGGTAGCCTTGTGAAAATAGTCACAGACAATGGATCAGCATTT
AGAAAAGCAGTCAAGTGGCTTGAAGAAAAGTATGGCATTAAAGGGGTAGCTATCTCCCCATACAATTCACAAGCT
AACGGAGTAATCGAGCGTCCTCACTGGGATGTCAGGCAAATGCTATACAAAGCTACAGCCGGAGATGTAAAGAAA
TGGTTCTGGCATCTTCATCACGTAGCTTGGGCAGACAGAATCACTGTAAGAAAGGGAACTGGATGTTCTCCTTAC
TTCATGATCACTGGCGCACATCCGACGTTGCCTCTAGACATAATCGAAGCAACTTGGTTGGTCAAATTCCCTGAG
ACACTCGTTTCCACAGCAGACTTGATTGGATTAAGAGCGCAAGCTCTAGCTAAGCACGTAACTCATGTCGAACAA
ATGCGACAAAGAGTCAACGATGAGAAGCTAAGACGAGCTCTTCAGTTAGAACAAACCATGCAGCATAAAATAAAA
GAGTTCAATCTAAAGTCAGGCGATCTAGCTTTAGTACGAAATTCAGCTATCGAAATGTCAGCGGACAGAAAAATG
AAATCTAGATATCTGGGGCCCGTAGTAATAGTCAAAAGACTCAAAGGCGGAGCCTACATAGTTTGCGAGTACGAC
GGATCAGTTTGGCAAAATAAAGTGGCAGCATTTCGTGTTGTACCGTACTTAGCTAGACAAAAGATCACACTCAGC
GACAAAGTTCAACAGCTATTGGACGCAGATATCGAAGAACTACAGCTCCTAGAAGAAACCACAGTAGACTCCGAC
ACAGGTAATGTCTCAGAACATGAGGACAATGCCTAG
Transcript >Agabi119p4|748850
ATGTTAAACAATCCTGGAAAGCTACCAAATGCAACGGTGAATCGCTGGGTGGACTACATCAGAACTCACTTCCAT
TTTACGCTTCTACACAAGAAAGGAAAAAGCTTTGGGCCAGACGGCCTATCGCGACGTAAATGGTACCCAGGGGAT
CCCTTAGCTAGACGATTCGATGATGGCTCCGAGGACGGAGAAGAGGACTTCGAACTAGTCAAGGAAAACCCTGAC
GACGAAGATCCTCTACCTCTTGAAGCTTTTGTCGACGAAATCGATAATCGAACAGGTTACCTTCAGCAGATAATA
AATGATACTCCGGTCTATCAACTGGCAAGAGTAGCTACAGAACAAGAAATACAGCAGCGAGCTCGACTAGCTACT
AGCGATAATTGTCTAGCTACATACAAAGTATTCTTAGGACAAGTGGCAACGCTAGAACAGTCAGCTTTAGAAGCA
TCAGAAGATGATCAGATCAGTCCCTACGATGAGGATAGACGCACCCTTGAAGCAAAGCGTCAAGATGCACAGCTA
CCAGCAATCAGAGAATGGCTAGCTAACGACCCAAAGAACGTGGACCTCCATAAAATGAGTCCAGCTAAAGCTCGT
TTTGTGAGAGCAGCTTCCCACTTCTGGCTAGATAAGGAAGGGAGACTCTTTCGAAAGATTGCAGGAGCCGGATTT
CCTCAGCTAGTGGTCGAAATAGAAGATCACATGAGAATAATGCGAGAATGCCATGATAAGCTAGGACATCGAGGC
GCTTATGCAACTAGTAAACTAATAGCTCAGCGCTTCTGGTGGCCAGAAGTAGATGGAGATGTAGCTTGTTACCCA
TACCCCTTCTATATTTCAAGTGTTGCATGCGGATACTGTTCATATGACTCCACCTTCAACGGATGTAAATACATT
GTTCATGGAAGGTGTGCGTTGTCATCTTGGATGGAAGCTAGAGCACTTAGGAAGGAAGATGCTAAAGCTATTGGA
ACTTGGATCTTCGAAGACATTATATGTCGATGGGGTAGCCTTGTGAAAATAGTCACAGACAATGGATCAGCATTT
AGAAAAGCAGTCAAGTGGCTTGAAGAAAAGTATGGCATTAAAGGGGTAGCTATCTCCCCATACAATTCACAAGCT
AACGGAGTAATCGAGCGTCCTCACTGGGATGTCAGGCAAATGCTATACAAAGCTACAGCCGGAGATGTAAAGAAA
TGGTTCTGGCATCTTCATCACGTAGCTTGGGCAGACAGAATCACTGTAAGAAAGGGAACTGGATGTTCTCCTTAC
TTCATGATCACTGGCGCACATCCGACGTTGCCTCTAGACATAATCGAAGCAACTTGGTTGGTCAAATTCCCTGAG
ACACTCGTTTCCACAGCAGACTTGATTGGATTAAGAGCGCAAGCTCTAGCTAAGCACGTAACTCATGTCGAACAA
ATGCGACAAAGAGTCAACGATGAGAAGCTAAGACGAGCTCTTCAGTTAGAACAAACCATGCAGCATAAAATAAAA
GAGTTCAATCTAAAGTCAGGCGATCTAGCTTTAGTACGAAATTCAGCTATCGAAATGTCAGCGGACAGAAAAATG
AAATCTAGATATCTGGGGCCCGTAGTAATAGTCAAAAGACTCAAAGGCGGAGCCTACATAGTTTGCGAGTACGAC
GGATCAGTTTGGCAAAATAAAGTGGCAGCATTTCGTGTTGTACCGTACTTAGCTAGACAAAAGATCACACTCAGC
GACAAAGTTCAACAGCTATTGGACGCAGATATCGAAGAACTACAGCTCCTAGAAGAAACCACAGTAGACTCCGAC
ACAGGTAATGTCTCAGAACATGAGGACAATGCCTAG
Gene >Agabi119p4|748850
ATGTTAAACAATCCTGGAAAGCTACCAAATGCAACGGTGAATCGCTGGGTGGACTACATCAGAACTCACTTCCAT
TTTACGCTTCTACACAAGAAAGGAAAAAGCTTTGGGCCAGACGGCCTATCGCGACGTAAATGGTACCCAGGGGAT
CCCTTAGCTAGACGATTCGATGATGGCTCCGAGGACGGAGAAGAGGACTTCGAACTAGTCAAGGAAAACCCTGAC
GACGAAGATCCTCTACCTCTTGAAGCTTTTGTCGACGAAATCGATAATCGAACAGGTTACCTTCAGCAGATAATA
AATGATACTCCGGTCTATCAACTGGCAAGAGTAGCTACAGAACAAGAAATACAGCAGCGAGCTCGACTAGCTACT
AGCGATAATTGTCTAGCTACATACAAAGTATTCTTAGGACAAGTGGCAACGCTAGAACAGTCAGCTTTAGAAGCA
TCAGAAGATGATCAGATCAGTCCCTACGATGAGGATAGACGCACCCTTGAAGCAAAGCGTCAAGATGCACAGCTA
CCAGCAATCAGAGAATGGCTAGCTAACGACCCAAAGAACGTGGACCTCCATAAAATGAGTCCAGCTAAAGCTCGT
TTTGTGAGAGCAGCTTCCCACTTCTGGCTAGATAAGGAAGGGAGACTCTTTCGAAAGATTGCAGGAGCCGGATTT
CCTCAGCTAGTGGTCGAAATAGAAGATCACATGAGAATAATGCGAGAATGCCATGATAAGCTAGGACATCGAGGC
GCTTATGCAACTAGTAAACTAATAGCTCAGCGCTTCTGGTGGCCAGAAGTAGATGGAGATGTAGCTTGGTACGTC
AAGTCATGTCATCTCTGCCAAGTCAGACAGAAAATGGCATTAGAATTGCCACCAGTAGTTACCCATACCCCTTCT
ATATTTCAAGTGTTGCATGCGGATACTGTTCATATGACTCCACCTTCAACGGATGTAAATACATTGTTCATGGAA
GGTGTGCGTTGTCATCTTGGATGGAAGCTAGAGCACTTAGGAAGGAAGATGCTAAAGCTATTGGAACTTGGATCT
TCGAAGACATTATATGTCGATGGGGTAGCCTTGTGAAAATAGTCACAGACAATGGATCAGCATTTAGAAAAGCAG
TCAAGTGGCTTGAAGAAAAGTATGGCATTAAAGGGGTAGCTATCTCCCCATACAATTCACAAGCTAACGGAGTAA
TCGAGCGTCCTCACTGGGATGTCAGGCAAATGCTATACAAAGCTACAGCCGGAGATGTAAAGAAATGGTTCTGGC
ATCTTCATCACGTAGCTTGGGCAGACAGAATCACTGTAAGAAAGGGAACTGGATGTTCTCCTTACTTCATGATCA
CTGGCGCACATCCGACGTTGCCTCTAGACATAATCGAAGCAACTTGGTTGGTCAAATTCCCTGAGACACTCGTTT
CCACAGCAGACTTGATTGGATTAAGAGCGCAAGCTCTAGCTAAGCACGTAACTCATGTCGAACAAATGCGACAAA
GAGTCAACGATGAGAAGCTAAGACGAGCTCTTCAGTTAGAACAAACCATGCAGCATAAAATAAAAGAGTTCAATC
TAAAGTCAGGCGATCTAGCTTTAGTACGAAATTCAGCTATCGAAATGTCAGCGGACAGAAAAATGAAATCTAGAT
ATCTGGGGCCCGTAGTAATAGTCAAAAGACTCAAAGGCGGAGCCTACATAGTTTGCGAGTACGACGGATCAGTTT
GGCAAAATAAAGTGGCAGCATTTCGTGTTGTACCGTACTTAGCTAGACAAAAGATCACACTCAGCGACAAAGTTC
AACAGCTATTGGACGCAGATATCGAAGAACTACAGCTCCTAGAAGAAACCACAGTAGACTCCGACACAGGTAATG
TCTCAGAACATGAGGACAATGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail