Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|748300
Gene name
Locationscaffold_11:216868..222151
Strand-
Gene length (bp)5283
Transcript length (bp)5283
Coding sequence length (bp)5283
Protein length (aa) 1761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 2.5E-30 1085 1186
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 6.6E-24 1053 1156
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 8.0E-22 826 987
PF17921 Integrase_H2C2 Integrase zinc binding domain 6.0E-15 1319 1374
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 3.1E-06 1697 1744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 749 1677 3.0E-114
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 749 1677 3.0E-114
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 749 1677 3.0E-114
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 749 1677 3.0E-114
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 749 1677 5.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 749 1677 3.0E-114
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 749 1677 3.0E-114
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 749 1677 3.0E-114
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 749 1677 3.0E-114
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 749 1677 5.0E-114
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 749 1677 5.0E-114
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 749 1677 5.0E-114
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 749 1677 5.0E-114
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 749 1677 3.0E-113
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 749 1677 3.0E-113
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 749 1677 4.0E-113
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 770 1673 3.0E-98
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 770 1662 5.0E-98
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 718 1511 2.0E-81
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 788 1506 1.0E-78
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 740 1671 9.0E-78
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 802 1506 1.0E-77
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 806 1506 4.0E-63
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 750 1213 2.0E-50
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 770 1206 2.0E-50
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 770 1206 6.0E-50
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 770 1206 7.0E-49
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 770 1206 7.0E-49
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 770 1206 8.0E-49
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 770 1206 6.0E-48
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 804 1206 3.0E-41
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 788 1206 2.0E-34
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 800 1206 3.0E-34
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 800 1206 3.0E-34
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 773 1102 8.0E-33
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 705 1217 1.0E-30
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 764 1191 6.0E-28
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 782 1207 1.0E-27
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 786 1184 6.0E-26
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 786 1184 1.0E-25
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 772 1206 5.0E-25
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 774 1160 3.0E-24
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 782 1184 3.0E-24
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 774 1169 8.0E-24
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 782 1206 6.0E-23
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 750 1160 3.0E-22
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 745 1160 5.0E-22
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 745 1160 6.0E-22
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 719 1220 7.0E-22
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 745 1160 7.0E-22
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 745 1160 1.0E-21
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 1309 1656 5.0E-21
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 750 1160 5.0E-21
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 745 1160 5.0E-21
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 745 1160 6.0E-21
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 774 1180 8.0E-21
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 745 1160 4.0E-20
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1313 1656 4.0E-19
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 1311 1545 8.0E-19
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1313 1656 1.0E-17
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 1275 1517 2.0E-16
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 724 1030 3.0E-15
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 835 957 6.0E-15
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 1321 1545 1.0E-14
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 796 1080 2.0E-14
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 796 1028 5.0E-14
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 796 992 8.0E-14
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 1397 1643 1.0E-13
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 857 1198 3.0E-13
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 796 1084 5.0E-13
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 796 1028 1.0E-12
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 1304 1643 2.0E-12
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 1397 1643 2.0E-12
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 1397 1643 2.0E-12
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 1397 1643 2.0E-12
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 788 1039 2.0E-12
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 1365 1643 3.0E-12
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 921 1201 4.0E-12
sp|P03354|POL_RSVP Gag-Pro-Pol polyprotein OS=Rous sarcoma virus (strain Prague C) GN=gag-pro-pol PE=1 SV=2 788 1067 4.0E-12
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 796 1084 4.0E-12
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 796 1031 4.0E-12
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 796 1031 6.0E-12
sp|O92956|POL_RSVSB Gag-Pro-Pol polyprotein OS=Rous sarcoma virus (strain Schmidt-Ruppin B) GN=gag-pro-pol PE=1 SV=2 788 1110 6.0E-12
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 788 1039 6.0E-12
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 788 1024 7.0E-12
sp|Q04095|POL_RSVSA Gag-Pro-Pol polyprotein OS=Avian leukosis virus RSA GN=gag-pro-pol PE=3 SV=2 788 1067 8.0E-12
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 1304 1643 8.0E-12
sp|Q7SQ98|POL_ALV Pol polyprotein OS=Avian leukosis virus GN=pol PE=3 SV=1 788 1067 8.0E-12
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 788 1024 8.0E-12
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 788 1024 1.0E-11
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 788 1024 1.0E-11
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 767 1024 1.0E-11
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 796 1031 1.0E-11
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 1397 1643 2.0E-11
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 1304 1643 3.0E-11
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 956 1090 3.0E-11
sp|P25059|POL_BLVAU Pol polyprotein OS=Bovine leukemia virus (isolate Australian) GN=pol PE=3 SV=1 796 1033 4.0E-11
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 1397 1643 5.0E-11
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 857 1191 5.0E-11
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 788 941 5.0E-11
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 1397 1643 6.0E-11
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 788 1024 7.0E-11
sp|P03361|POL_BLVJ Pol polyprotein OS=Bovine leukemia virus (isolate Japanese BLV-1) GN=pol PE=3 SV=1 796 1033 8.0E-11
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 1348 1643 2.0E-10
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 796 1031 4.0E-10
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 1397 1643 1.0E-09
sp|P63128|POK9_HUMAN Endogenous retrovirus group K member 9 Pol protein OS=Homo sapiens GN=ERVK-9 PE=3 SV=3 788 926 2.0E-09
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 799 1091 2.0E-09
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 801 986 3.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 768 1028 5.0E-09
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 1309 1643 2.0E-08
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 743 1055 3.0E-08
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 1332 1643 1.0E-07
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 1329 1526 1.0E-07
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 1397 1643 2.0E-07
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 768 1091 2.0E-07
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 1309 1530 3.0E-07
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 1309 1526 4.0E-07
sp|P03370|POL_VILV Pol polyprotein OS=Maedi visna virus (strain 1514) GN=pol PE=3 SV=1 796 966 6.0E-07
sp|P23427|POL_VILV2 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=pol PE=3 SV=1 796 966 6.0E-07
sp|P35956|POL_VILVK Pol polyprotein OS=Maedi visna virus (strain KV1772) GN=pol PE=1 SV=1 796 966 6.0E-07
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 1116 1206 1.0E-06
sp|P23426|POL_VILV1 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS1) GN=pol PE=3 SV=1 773 966 1.0E-06
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 784 966 1.0E-06
sp|Q89928|POL_HV2EH Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) GN=gag-pol PE=3 SV=3 774 1085 2.0E-06
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 780 1053 2.0E-06
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 796 966 2.0E-06
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 784 966 3.0E-06
sp|P03371|POL_EIAVY Pol polyprotein OS=Equine infectious anemia virus (strain Wyoming) GN=pol PE=3 SV=1 736 1031 3.0E-06
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 803 1097 4.0E-06
sp|Q76634|POL_HV2UC Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) GN=gag-pol PE=3 SV=3 774 1085 4.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 786 966 4.0E-06
sp|P05896|POL_SIVM1 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate Mm142-83) GN=gag-pol PE=1 SV=2 803 1097 4.0E-06
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 774 966 4.0E-06
sp|P12898|DPOL_WHV4 Protein P OS=Woodchuck hepatitis B virus (isolate 7) GN=P PE=3 SV=1 906 1050 6.0E-06
sp|P11292|DPOL_WHV6 Protein P (Fragment) OS=Woodchuck hepatitis B virus (isolate w64/pWS23) GN=P PE=2 SV=1 906 1050 6.0E-06
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 778 1053 6.0E-06
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 774 966 7.0E-06
sp|P17396|DPOL_WHV5 Protein P OS=Woodchuck hepatitis B virus (isolate 8) GN=P PE=3 SV=1 906 1038 8.0E-06
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 802 1031 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|748300
MHTAYTVASQRPSKPKGPGPLSGPNSLLPTLEVIPTSSPASSSRDHTDTALLRSGKLVPKSTVPIHNDHSQGILA
HISAHIPTSDTSNTDLLLAVPQSVVEPQLNVHEVIDHEDLDSSDDQLLLASLPQSPAPTTSQQLTLSANLPLTTA
SSPDTESDSESDSDSSSDFDMGKSPITISAGIELSKVGGLPRVTATTLTPSILRDLEDYANVCYQVGRKVAPAKQ
LKKLAACFSNIEHMSWVLTEADLQPEGTTLSAFLDKMRKRFLPNNWELLIEAEREAEIMHEDDTYMDWATRIKKK
NNILKGTPCHLNDKRLRLFLLSHLEHGLKGIVFSATDDKGTKVTDIKEFSHWEQEVQRLDTLRASQRASQRQLVL
SMMNDNDRHRDSKPGKSKGKKQSDGKISSDRCPPLTGDERTILYKYDGCLKCRKVFQDHISKDCTAAWPKKDGYR
AVQEPPQSDIDAWKKKPSGSRDKRSRSDHASHASSSHPSKRAKKDVAAAILESESDSSEADDVIAAIEDDGETTD
EVRGRHLYWDCSLTGPNSESPVNTTALLDSGAHVVLIRDTLVSELGLKRFPLSDTFSVRGAMSTHRSFINEYVYI
VLSSCDMSYTARPVRALIIGELSAPIILGMPFLSRNAIQINHHTRVVTDTLQNVNLLGSGSTTHTKPIKRDTDAH
PNPKHKKRNAQLTTAPYRKLLVESLKDKLRTTKMTLSPHQHTSSSDAHEVVAAIHKRITQVIDEEVLRRLHAKIV
SEFASVFSAMPKVSCLPKDIEADIRLKDPQLTVKPRTYSCPRRYKEAWKKLIDDHLEAGRIQPSASPFASPSFCI
PKSDPSAPPRWVNDYRELNKNTVPDNYALPKVDDVLNDCAKGKYFAVIDMTNAFFQTRMRAKDIHKTAVTTPFGS
FEWKVMPMGLRNAPAIHQRRINKALRAHIGKICQAYIDDIVIWSHTLSEHETNVRLILSTLQQAGLYCNLKKTKL
FCTEINFLGHHISSDGIRADDRKAEKIVNWPIPQNAKDVRQFLGLVRYVAVFLPDLARYSTILNKLTDKSSVTDF
PDWNDSHQHAFDKIKELVLSRDCLTTIDYTAMPLKRVFVSTDASDFASGAVLSFGETFETARPVAFESKSFKGAE
LNYPVHEKELFAIVRALEKWRVDLLGVPFTVLTDHRTLECFNTQRHLSRRQARWMEFLQQYDFSIVYLRGEDNVA
ADALSRTTFTNAISEQDAFHMSPCDRLDELDISVCATLDNALTPQAEWAAMLSLLPNDTIAHTLDIAADDELRDS
ILAGYTNDTWCTKLLATWQQMHNVVLRGGLLFFEDRLIIPRTGNVRETIFALAHDSLGHFGLDKSYEALRGSFYW
PGMHTDLEKLYVPKCAQCQRMKSSTKKPIGPLHPLPIPDHRFQAVAIDFVGPLPEELGFNCIFTMTDRLGADVRL
VPTTMNATAVDTAQLFFHHWYCENGLPQEIVSDRDKLFTSSFWRSLHELTGTALKMSTSFHPQTDGASERTNKTL
NQCLRMHVDSMQRGWVKALPAIRFAMMNTQNASTGLTGFQLRMGCSPRVIPPIYRDNSDLPTESPEDFLFRVSSL
EAQARDTLLQHKVLQAHQANKHRDTSPFPFVVGGRVKLSTANRRKKLSVEGAKRVAKLMPRFEGPYVIRAVNEEN
STVTLEIPRRGHHNGTESFHTSLVRQWVEDDAQVFDRPPLNDAGEAEVEEIVERRKIGRGWSYRVKYRGYPEEEN
QWLPGREVENLEALDRFFAREGLTELGQTVSLSSG*
Coding >Agabi119p4|748300
ATGCATACAGCATACACCGTGGCGTCTCAACGTCCTTCGAAACCGAAAGGTCCAGGTCCTCTCTCTGGTCCAAAC
AGTCTTTTGCCTACGCTGGAGGTCATTCCGACTTCCTCCCCTGCGTCTTCTTCGCGAGACCATACCGACACTGCT
CTTTTACGTTCCGGAAAACTGGTTCCGAAATCTACTGTACCGATACACAACGACCACAGTCAAGGTATTTTGGCG
CATATATCGGCGCATATACCCACTTCTGATACTAGCAACACCGACCTACTTCTTGCAGTTCCACAGAGCGTTGTT
GAGCCTCAACTGAACGTACACGAAGTAATTGACCACGAAGACCTTGATTCCAGCGACGATCAACTTCTACTTGCA
TCTCTACCTCAGTCACCCGCACCGACTACATCACAACAGCTCACTCTGTCAGCGAACTTGCCGTTGACTACTGCT
TCCTCTCCTGACACCGAATCCGACTCTGAATCCGACTCCGATTCATCTTCCGATTTTGACATGGGTAAATCACCT
ATCACCATCAGCGCCGGAATTGAACTGTCGAAAGTTGGTGGATTACCTCGGGTCACTGCTACCACTCTCACTCCG
TCGATCCTCCGTGACCTCGAGGACTACGCGAACGTTTGTTACCAGGTTGGCAGGAAAGTCGCTCCAGCAAAACAA
CTGAAGAAGTTGGCGGCTTGCTTCTCGAACATTGAACATATGTCATGGGTTTTAACGGAAGCTGATCTACAACCA
GAGGGAACCACGTTGAGTGCTTTCTTGGACAAAATGCGTAAACGTTTCTTACCCAATAATTGGGAGCTCCTCATC
GAGGCCGAACGCGAGGCCGAAATCATGCATGAGGACGACACATACATGGATTGGGCTACTCGTATTAAGAAGAAG
AACAACATTCTTAAAGGAACCCCTTGCCATTTAAACGACAAACGCTTGCGCCTCTTCTTACTGTCCCATCTCGAG
CATGGCCTGAAGGGCATTGTATTCTCGGCTACAGACGACAAAGGTACCAAAGTTACAGATATCAAAGAGTTCAGC
CACTGGGAACAGGAGGTCCAGCGCTTGGATACATTACGAGCTTCACAACGTGCATCTCAACGACAGCTTGTCTTG
AGCATGATGAACGACAACGACCGCCACCGTGATTCCAAACCAGGAAAGTCGAAAGGCAAGAAGCAGAGCGACGGA
AAAATCTCTTCTGACAGATGTCCTCCTCTTACTGGCGACGAACGTACCATCCTATACAAGTATGACGGCTGTTTG
AAATGTCGTAAGGTTTTCCAGGACCACATCTCGAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGGTATCGT
GCTGTACAAGAACCTCCCCAGTCGGATATTGACGCTTGGAAGAAGAAACCTTCCGGTAGTCGGGATAAACGATCA
CGCTCTGATCATGCCTCGCATGCGTCTTCTTCTCATCCTAGCAAACGTGCTAAAAAGGATGTTGCTGCTGCGATA
TTGGAATCGGAGAGTGATAGTTCCGAAGCTGACGATGTGATTGCTGCAATTGAGGATGACGGCGAGACTACCGAC
GAAGTGCGTGGCAGACACCTTTACTGGGATTGCTCACTAACGGGTCCTAATAGTGAATCTCCTGTTAACACTACG
GCATTACTGGACAGTGGGGCACATGTTGTCCTTATTCGCGACACCTTAGTTTCAGAGCTCGGACTCAAACGTTTT
CCGCTTAGCGATACCTTCTCTGTTCGTGGTGCCATGTCTACCCATCGCTCGTTTATAAATGAATATGTTTACATC
GTTCTCTCCTCATGTGATATGTCCTACACTGCACGTCCTGTGAGAGCTCTTATAATTGGCGAATTGTCTGCACCA
ATTATTCTGGGAATGCCTTTCCTGTCCCGAAATGCTATTCAAATTAATCATCACACAAGAGTCGTCACAGATACA
TTGCAAAACGTCAATTTGCTCGGGTCTGGTAGCACTACGCATACCAAACCCATAAAACGAGACACTGATGCGCAT
CCGAACCCAAAACATAAGAAGCGCAATGCTCAGCTTACCACTGCGCCTTACCGAAAATTACTTGTGGAGAGTCTT
AAAGATAAACTGCGTACCACGAAAATGACTCTGTCTCCACACCAACATACATCTTCTTCTGATGCGCACGAAGTG
GTTGCTGCGATTCACAAGCGCATAACACAAGTCATTGATGAAGAAGTATTACGTCGGTTACATGCCAAAATTGTC
TCCGAGTTTGCTTCTGTTTTTTCTGCCATGCCTAAAGTATCTTGTCTTCCTAAAGACATTGAAGCTGACATTAGA
CTTAAAGATCCCCAGTTGACTGTTAAGCCACGTACCTATAGTTGCCCTCGTCGTTATAAGGAGGCTTGGAAGAAA
CTTATTGATGACCACCTGGAGGCTGGTCGTATTCAACCGTCTGCTTCGCCTTTCGCGTCACCTTCTTTTTGCATC
CCAAAATCTGATCCTTCCGCTCCACCTCGTTGGGTAAACGATTATCGAGAATTGAACAAAAACACCGTCCCTGAC
AATTATGCATTGCCTAAGGTTGACGATGTCTTGAATGACTGTGCTAAAGGAAAATATTTTGCTGTCATCGACATG
ACAAATGCCTTTTTCCAAACTCGCATGCGAGCAAAAGACATTCACAAAACAGCTGTAACCACTCCGTTTGGTTCT
TTTGAATGGAAGGTCATGCCGATGGGTTTGCGCAACGCACCTGCGATCCACCAACGTCGTATTAACAAGGCTTTA
CGTGCCCACATTGGGAAAATCTGTCAAGCTTATATCGACGACATTGTGATTTGGTCGCATACACTGTCTGAACAC
GAAACTAATGTACGGTTGATTTTGTCAACATTACAACAAGCGGGTTTGTACTGCAACCTGAAGAAGACAAAATTG
TTCTGCACCGAAATAAATTTCCTTGGACACCACATCAGTTCTGACGGTATACGAGCAGACGACCGTAAGGCTGAG
AAAATTGTCAACTGGCCGATCCCACAGAATGCTAAGGATGTCCGTCAGTTCTTAGGCCTCGTTCGCTACGTGGCT
GTCTTTTTACCAGACCTTGCTCGTTATTCGACGATTCTTAATAAGCTCACTGATAAATCATCTGTCACGGACTTT
CCTGACTGGAATGACTCGCATCAACATGCGTTCGACAAAATTAAAGAATTAGTGCTCTCACGCGACTGCTTGACG
ACTATTGATTACACCGCAATGCCACTGAAGCGAGTTTTTGTCTCTACCGATGCTTCCGATTTTGCAAGCGGTGCC
GTCCTCTCTTTTGGCGAGACTTTTGAAACCGCGCGACCTGTGGCTTTTGAATCTAAGTCGTTCAAGGGTGCTGAA
CTTAACTATCCGGTCCACGAGAAGGAGCTTTTTGCAATTGTTAGAGCACTCGAAAAATGGCGGGTCGACCTGCTT
GGCGTACCTTTTACGGTCCTCACTGACCACCGGACACTCGAGTGTTTCAACACACAACGGCACTTATCCCGTCGC
CAAGCCCGGTGGATGGAGTTTCTACAACAATACGATTTCAGCATTGTTTATCTTCGAGGTGAAGACAATGTCGCC
GCCGACGCGTTATCACGGACCACATTTACAAATGCAATTTCCGAGCAAGATGCTTTCCATATGTCCCCCTGTGAT
CGTTTGGATGAACTGGACATTTCAGTGTGTGCGACATTGGACAATGCACTCACACCTCAAGCGGAATGGGCTGCC
ATGCTGTCCCTCCTCCCTAACGACACTATTGCCCACACGCTTGATATCGCAGCTGATGATGAGCTTCGTGACTCT
ATTCTTGCTGGCTACACAAACGATACATGGTGCACGAAACTACTGGCCACTTGGCAACAAATGCACAATGTGGTG
TTGCGCGGTGGTTTGCTGTTTTTCGAAGATCGTCTCATCATCCCCCGTACCGGGAACGTACGGGAAACAATATTC
GCCCTCGCTCATGATTCTTTGGGTCACTTCGGGCTCGATAAATCCTACGAGGCGCTACGTGGCTCGTTTTACTGG
CCTGGAATGCACACGGATCTGGAAAAATTGTACGTGCCTAAATGTGCACAATGTCAACGAATGAAATCTTCCACG
AAGAAACCTATCGGTCCTCTGCATCCCCTTCCCATACCTGACCATCGTTTCCAAGCGGTTGCTATCGATTTCGTT
GGGCCATTGCCTGAGGAACTTGGATTCAATTGTATCTTCACGATGACCGACCGCCTTGGAGCCGATGTTCGCCTT
GTCCCGACCACCATGAACGCTACAGCTGTGGATACCGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAATGGT
TTACCTCAAGAAATTGTATCTGATCGAGACAAATTGTTCACATCCTCCTTTTGGCGTTCACTCCACGAATTAACT
GGTACCGCTTTGAAAATGTCTACATCGTTCCATCCACAGACTGATGGTGCCAGCGAACGTACCAATAAAACTCTG
AACCAGTGTCTGCGCATGCATGTTGACAGCATGCAGCGAGGATGGGTTAAAGCCTTACCAGCTATCCGGTTCGCT
ATGATGAATACTCAGAACGCCTCAACTGGGCTCACGGGTTTCCAACTCCGTATGGGTTGCTCACCTCGAGTAATT
CCGCCTATCTACCGTGATAACTCTGATTTGCCCACCGAGTCTCCCGAAGATTTCCTGTTCAGAGTCTCTTCGTTA
GAAGCACAAGCTCGAGACACATTGTTACAGCATAAAGTCCTCCAGGCTCACCAAGCTAACAAACATCGCGATACA
TCTCCTTTCCCATTCGTTGTGGGTGGGCGAGTGAAGTTGTCTACTGCAAATCGACGCAAAAAGCTCTCCGTCGAA
GGAGCGAAACGTGTTGCTAAGCTCATGCCTCGGTTTGAAGGACCCTATGTGATTAGAGCTGTAAACGAAGAAAAC
AGTACTGTCACGTTGGAAATCCCGCGACGGGGTCATCATAATGGTACGGAATCGTTTCATACATCCCTTGTTCGT
CAATGGGTGGAAGACGACGCGCAAGTTTTCGACCGACCACCTCTCAACGACGCCGGAGAAGCTGAGGTGGAAGAA
ATAGTGGAGCGTCGAAAGATTGGTCGCGGTTGGAGTTACCGTGTGAAATACAGGGGTTACCCCGAAGAAGAGAAC
CAATGGTTACCTGGCAGAGAAGTCGAGAATCTTGAAGCACTCGACCGCTTTTTCGCCCGTGAAGGTCTTACAGAA
CTGGGACAGACCGTTTCATTGTCATCTGGGTAG
Transcript >Agabi119p4|748300
ATGCATACAGCATACACCGTGGCGTCTCAACGTCCTTCGAAACCGAAAGGTCCAGGTCCTCTCTCTGGTCCAAAC
AGTCTTTTGCCTACGCTGGAGGTCATTCCGACTTCCTCCCCTGCGTCTTCTTCGCGAGACCATACCGACACTGCT
CTTTTACGTTCCGGAAAACTGGTTCCGAAATCTACTGTACCGATACACAACGACCACAGTCAAGGTATTTTGGCG
CATATATCGGCGCATATACCCACTTCTGATACTAGCAACACCGACCTACTTCTTGCAGTTCCACAGAGCGTTGTT
GAGCCTCAACTGAACGTACACGAAGTAATTGACCACGAAGACCTTGATTCCAGCGACGATCAACTTCTACTTGCA
TCTCTACCTCAGTCACCCGCACCGACTACATCACAACAGCTCACTCTGTCAGCGAACTTGCCGTTGACTACTGCT
TCCTCTCCTGACACCGAATCCGACTCTGAATCCGACTCCGATTCATCTTCCGATTTTGACATGGGTAAATCACCT
ATCACCATCAGCGCCGGAATTGAACTGTCGAAAGTTGGTGGATTACCTCGGGTCACTGCTACCACTCTCACTCCG
TCGATCCTCCGTGACCTCGAGGACTACGCGAACGTTTGTTACCAGGTTGGCAGGAAAGTCGCTCCAGCAAAACAA
CTGAAGAAGTTGGCGGCTTGCTTCTCGAACATTGAACATATGTCATGGGTTTTAACGGAAGCTGATCTACAACCA
GAGGGAACCACGTTGAGTGCTTTCTTGGACAAAATGCGTAAACGTTTCTTACCCAATAATTGGGAGCTCCTCATC
GAGGCCGAACGCGAGGCCGAAATCATGCATGAGGACGACACATACATGGATTGGGCTACTCGTATTAAGAAGAAG
AACAACATTCTTAAAGGAACCCCTTGCCATTTAAACGACAAACGCTTGCGCCTCTTCTTACTGTCCCATCTCGAG
CATGGCCTGAAGGGCATTGTATTCTCGGCTACAGACGACAAAGGTACCAAAGTTACAGATATCAAAGAGTTCAGC
CACTGGGAACAGGAGGTCCAGCGCTTGGATACATTACGAGCTTCACAACGTGCATCTCAACGACAGCTTGTCTTG
AGCATGATGAACGACAACGACCGCCACCGTGATTCCAAACCAGGAAAGTCGAAAGGCAAGAAGCAGAGCGACGGA
AAAATCTCTTCTGACAGATGTCCTCCTCTTACTGGCGACGAACGTACCATCCTATACAAGTATGACGGCTGTTTG
AAATGTCGTAAGGTTTTCCAGGACCACATCTCGAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGGTATCGT
GCTGTACAAGAACCTCCCCAGTCGGATATTGACGCTTGGAAGAAGAAACCTTCCGGTAGTCGGGATAAACGATCA
CGCTCTGATCATGCCTCGCATGCGTCTTCTTCTCATCCTAGCAAACGTGCTAAAAAGGATGTTGCTGCTGCGATA
TTGGAATCGGAGAGTGATAGTTCCGAAGCTGACGATGTGATTGCTGCAATTGAGGATGACGGCGAGACTACCGAC
GAAGTGCGTGGCAGACACCTTTACTGGGATTGCTCACTAACGGGTCCTAATAGTGAATCTCCTGTTAACACTACG
GCATTACTGGACAGTGGGGCACATGTTGTCCTTATTCGCGACACCTTAGTTTCAGAGCTCGGACTCAAACGTTTT
CCGCTTAGCGATACCTTCTCTGTTCGTGGTGCCATGTCTACCCATCGCTCGTTTATAAATGAATATGTTTACATC
GTTCTCTCCTCATGTGATATGTCCTACACTGCACGTCCTGTGAGAGCTCTTATAATTGGCGAATTGTCTGCACCA
ATTATTCTGGGAATGCCTTTCCTGTCCCGAAATGCTATTCAAATTAATCATCACACAAGAGTCGTCACAGATACA
TTGCAAAACGTCAATTTGCTCGGGTCTGGTAGCACTACGCATACCAAACCCATAAAACGAGACACTGATGCGCAT
CCGAACCCAAAACATAAGAAGCGCAATGCTCAGCTTACCACTGCGCCTTACCGAAAATTACTTGTGGAGAGTCTT
AAAGATAAACTGCGTACCACGAAAATGACTCTGTCTCCACACCAACATACATCTTCTTCTGATGCGCACGAAGTG
GTTGCTGCGATTCACAAGCGCATAACACAAGTCATTGATGAAGAAGTATTACGTCGGTTACATGCCAAAATTGTC
TCCGAGTTTGCTTCTGTTTTTTCTGCCATGCCTAAAGTATCTTGTCTTCCTAAAGACATTGAAGCTGACATTAGA
CTTAAAGATCCCCAGTTGACTGTTAAGCCACGTACCTATAGTTGCCCTCGTCGTTATAAGGAGGCTTGGAAGAAA
CTTATTGATGACCACCTGGAGGCTGGTCGTATTCAACCGTCTGCTTCGCCTTTCGCGTCACCTTCTTTTTGCATC
CCAAAATCTGATCCTTCCGCTCCACCTCGTTGGGTAAACGATTATCGAGAATTGAACAAAAACACCGTCCCTGAC
AATTATGCATTGCCTAAGGTTGACGATGTCTTGAATGACTGTGCTAAAGGAAAATATTTTGCTGTCATCGACATG
ACAAATGCCTTTTTCCAAACTCGCATGCGAGCAAAAGACATTCACAAAACAGCTGTAACCACTCCGTTTGGTTCT
TTTGAATGGAAGGTCATGCCGATGGGTTTGCGCAACGCACCTGCGATCCACCAACGTCGTATTAACAAGGCTTTA
CGTGCCCACATTGGGAAAATCTGTCAAGCTTATATCGACGACATTGTGATTTGGTCGCATACACTGTCTGAACAC
GAAACTAATGTACGGTTGATTTTGTCAACATTACAACAAGCGGGTTTGTACTGCAACCTGAAGAAGACAAAATTG
TTCTGCACCGAAATAAATTTCCTTGGACACCACATCAGTTCTGACGGTATACGAGCAGACGACCGTAAGGCTGAG
AAAATTGTCAACTGGCCGATCCCACAGAATGCTAAGGATGTCCGTCAGTTCTTAGGCCTCGTTCGCTACGTGGCT
GTCTTTTTACCAGACCTTGCTCGTTATTCGACGATTCTTAATAAGCTCACTGATAAATCATCTGTCACGGACTTT
CCTGACTGGAATGACTCGCATCAACATGCGTTCGACAAAATTAAAGAATTAGTGCTCTCACGCGACTGCTTGACG
ACTATTGATTACACCGCAATGCCACTGAAGCGAGTTTTTGTCTCTACCGATGCTTCCGATTTTGCAAGCGGTGCC
GTCCTCTCTTTTGGCGAGACTTTTGAAACCGCGCGACCTGTGGCTTTTGAATCTAAGTCGTTCAAGGGTGCTGAA
CTTAACTATCCGGTCCACGAGAAGGAGCTTTTTGCAATTGTTAGAGCACTCGAAAAATGGCGGGTCGACCTGCTT
GGCGTACCTTTTACGGTCCTCACTGACCACCGGACACTCGAGTGTTTCAACACACAACGGCACTTATCCCGTCGC
CAAGCCCGGTGGATGGAGTTTCTACAACAATACGATTTCAGCATTGTTTATCTTCGAGGTGAAGACAATGTCGCC
GCCGACGCGTTATCACGGACCACATTTACAAATGCAATTTCCGAGCAAGATGCTTTCCATATGTCCCCCTGTGAT
CGTTTGGATGAACTGGACATTTCAGTGTGTGCGACATTGGACAATGCACTCACACCTCAAGCGGAATGGGCTGCC
ATGCTGTCCCTCCTCCCTAACGACACTATTGCCCACACGCTTGATATCGCAGCTGATGATGAGCTTCGTGACTCT
ATTCTTGCTGGCTACACAAACGATACATGGTGCACGAAACTACTGGCCACTTGGCAACAAATGCACAATGTGGTG
TTGCGCGGTGGTTTGCTGTTTTTCGAAGATCGTCTCATCATCCCCCGTACCGGGAACGTACGGGAAACAATATTC
GCCCTCGCTCATGATTCTTTGGGTCACTTCGGGCTCGATAAATCCTACGAGGCGCTACGTGGCTCGTTTTACTGG
CCTGGAATGCACACGGATCTGGAAAAATTGTACGTGCCTAAATGTGCACAATGTCAACGAATGAAATCTTCCACG
AAGAAACCTATCGGTCCTCTGCATCCCCTTCCCATACCTGACCATCGTTTCCAAGCGGTTGCTATCGATTTCGTT
GGGCCATTGCCTGAGGAACTTGGATTCAATTGTATCTTCACGATGACCGACCGCCTTGGAGCCGATGTTCGCCTT
GTCCCGACCACCATGAACGCTACAGCTGTGGATACCGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAATGGT
TTACCTCAAGAAATTGTATCTGATCGAGACAAATTGTTCACATCCTCCTTTTGGCGTTCACTCCACGAATTAACT
GGTACCGCTTTGAAAATGTCTACATCGTTCCATCCACAGACTGATGGTGCCAGCGAACGTACCAATAAAACTCTG
AACCAGTGTCTGCGCATGCATGTTGACAGCATGCAGCGAGGATGGGTTAAAGCCTTACCAGCTATCCGGTTCGCT
ATGATGAATACTCAGAACGCCTCAACTGGGCTCACGGGTTTCCAACTCCGTATGGGTTGCTCACCTCGAGTAATT
CCGCCTATCTACCGTGATAACTCTGATTTGCCCACCGAGTCTCCCGAAGATTTCCTGTTCAGAGTCTCTTCGTTA
GAAGCACAAGCTCGAGACACATTGTTACAGCATAAAGTCCTCCAGGCTCACCAAGCTAACAAACATCGCGATACA
TCTCCTTTCCCATTCGTTGTGGGTGGGCGAGTGAAGTTGTCTACTGCAAATCGACGCAAAAAGCTCTCCGTCGAA
GGAGCGAAACGTGTTGCTAAGCTCATGCCTCGGTTTGAAGGACCCTATGTGATTAGAGCTGTAAACGAAGAAAAC
AGTACTGTCACGTTGGAAATCCCGCGACGGGGTCATCATAATGGTACGGAATCGTTTCATACATCCCTTGTTCGT
CAATGGGTGGAAGACGACGCGCAAGTTTTCGACCGACCACCTCTCAACGACGCCGGAGAAGCTGAGGTGGAAGAA
ATAGTGGAGCGTCGAAAGATTGGTCGCGGTTGGAGTTACCGTGTGAAATACAGGGGTTACCCCGAAGAAGAGAAC
CAATGGTTACCTGGCAGAGAAGTCGAGAATCTTGAAGCACTCGACCGCTTTTTCGCCCGTGAAGGTCTTACAGAA
CTGGGACAGACCGTTTCATTGTCATCTGGGTAG
Gene >Agabi119p4|748300
ATGCATACAGCATACACCGTGGCGTCTCAACGTCCTTCGAAACCGAAAGGTCCAGGTCCTCTCTCTGGTCCAAAC
AGTCTTTTGCCTACGCTGGAGGTCATTCCGACTTCCTCCCCTGCGTCTTCTTCGCGAGACCATACCGACACTGCT
CTTTTACGTTCCGGAAAACTGGTTCCGAAATCTACTGTACCGATACACAACGACCACAGTCAAGGTATTTTGGCG
CATATATCGGCGCATATACCCACTTCTGATACTAGCAACACCGACCTACTTCTTGCAGTTCCACAGAGCGTTGTT
GAGCCTCAACTGAACGTACACGAAGTAATTGACCACGAAGACCTTGATTCCAGCGACGATCAACTTCTACTTGCA
TCTCTACCTCAGTCACCCGCACCGACTACATCACAACAGCTCACTCTGTCAGCGAACTTGCCGTTGACTACTGCT
TCCTCTCCTGACACCGAATCCGACTCTGAATCCGACTCCGATTCATCTTCCGATTTTGACATGGGTAAATCACCT
ATCACCATCAGCGCCGGAATTGAACTGTCGAAAGTTGGTGGATTACCTCGGGTCACTGCTACCACTCTCACTCCG
TCGATCCTCCGTGACCTCGAGGACTACGCGAACGTTTGTTACCAGGTTGGCAGGAAAGTCGCTCCAGCAAAACAA
CTGAAGAAGTTGGCGGCTTGCTTCTCGAACATTGAACATATGTCATGGGTTTTAACGGAAGCTGATCTACAACCA
GAGGGAACCACGTTGAGTGCTTTCTTGGACAAAATGCGTAAACGTTTCTTACCCAATAATTGGGAGCTCCTCATC
GAGGCCGAACGCGAGGCCGAAATCATGCATGAGGACGACACATACATGGATTGGGCTACTCGTATTAAGAAGAAG
AACAACATTCTTAAAGGAACCCCTTGCCATTTAAACGACAAACGCTTGCGCCTCTTCTTACTGTCCCATCTCGAG
CATGGCCTGAAGGGCATTGTATTCTCGGCTACAGACGACAAAGGTACCAAAGTTACAGATATCAAAGAGTTCAGC
CACTGGGAACAGGAGGTCCAGCGCTTGGATACATTACGAGCTTCACAACGTGCATCTCAACGACAGCTTGTCTTG
AGCATGATGAACGACAACGACCGCCACCGTGATTCCAAACCAGGAAAGTCGAAAGGCAAGAAGCAGAGCGACGGA
AAAATCTCTTCTGACAGATGTCCTCCTCTTACTGGCGACGAACGTACCATCCTATACAAGTATGACGGCTGTTTG
AAATGTCGTAAGGTTTTCCAGGACCACATCTCGAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGGTATCGT
GCTGTACAAGAACCTCCCCAGTCGGATATTGACGCTTGGAAGAAGAAACCTTCCGGTAGTCGGGATAAACGATCA
CGCTCTGATCATGCCTCGCATGCGTCTTCTTCTCATCCTAGCAAACGTGCTAAAAAGGATGTTGCTGCTGCGATA
TTGGAATCGGAGAGTGATAGTTCCGAAGCTGACGATGTGATTGCTGCAATTGAGGATGACGGCGAGACTACCGAC
GAAGTGCGTGGCAGACACCTTTACTGGGATTGCTCACTAACGGGTCCTAATAGTGAATCTCCTGTTAACACTACG
GCATTACTGGACAGTGGGGCACATGTTGTCCTTATTCGCGACACCTTAGTTTCAGAGCTCGGACTCAAACGTTTT
CCGCTTAGCGATACCTTCTCTGTTCGTGGTGCCATGTCTACCCATCGCTCGTTTATAAATGAATATGTTTACATC
GTTCTCTCCTCATGTGATATGTCCTACACTGCACGTCCTGTGAGAGCTCTTATAATTGGCGAATTGTCTGCACCA
ATTATTCTGGGAATGCCTTTCCTGTCCCGAAATGCTATTCAAATTAATCATCACACAAGAGTCGTCACAGATACA
TTGCAAAACGTCAATTTGCTCGGGTCTGGTAGCACTACGCATACCAAACCCATAAAACGAGACACTGATGCGCAT
CCGAACCCAAAACATAAGAAGCGCAATGCTCAGCTTACCACTGCGCCTTACCGAAAATTACTTGTGGAGAGTCTT
AAAGATAAACTGCGTACCACGAAAATGACTCTGTCTCCACACCAACATACATCTTCTTCTGATGCGCACGAAGTG
GTTGCTGCGATTCACAAGCGCATAACACAAGTCATTGATGAAGAAGTATTACGTCGGTTACATGCCAAAATTGTC
TCCGAGTTTGCTTCTGTTTTTTCTGCCATGCCTAAAGTATCTTGTCTTCCTAAAGACATTGAAGCTGACATTAGA
CTTAAAGATCCCCAGTTGACTGTTAAGCCACGTACCTATAGTTGCCCTCGTCGTTATAAGGAGGCTTGGAAGAAA
CTTATTGATGACCACCTGGAGGCTGGTCGTATTCAACCGTCTGCTTCGCCTTTCGCGTCACCTTCTTTTTGCATC
CCAAAATCTGATCCTTCCGCTCCACCTCGTTGGGTAAACGATTATCGAGAATTGAACAAAAACACCGTCCCTGAC
AATTATGCATTGCCTAAGGTTGACGATGTCTTGAATGACTGTGCTAAAGGAAAATATTTTGCTGTCATCGACATG
ACAAATGCCTTTTTCCAAACTCGCATGCGAGCAAAAGACATTCACAAAACAGCTGTAACCACTCCGTTTGGTTCT
TTTGAATGGAAGGTCATGCCGATGGGTTTGCGCAACGCACCTGCGATCCACCAACGTCGTATTAACAAGGCTTTA
CGTGCCCACATTGGGAAAATCTGTCAAGCTTATATCGACGACATTGTGATTTGGTCGCATACACTGTCTGAACAC
GAAACTAATGTACGGTTGATTTTGTCAACATTACAACAAGCGGGTTTGTACTGCAACCTGAAGAAGACAAAATTG
TTCTGCACCGAAATAAATTTCCTTGGACACCACATCAGTTCTGACGGTATACGAGCAGACGACCGTAAGGCTGAG
AAAATTGTCAACTGGCCGATCCCACAGAATGCTAAGGATGTCCGTCAGTTCTTAGGCCTCGTTCGCTACGTGGCT
GTCTTTTTACCAGACCTTGCTCGTTATTCGACGATTCTTAATAAGCTCACTGATAAATCATCTGTCACGGACTTT
CCTGACTGGAATGACTCGCATCAACATGCGTTCGACAAAATTAAAGAATTAGTGCTCTCACGCGACTGCTTGACG
ACTATTGATTACACCGCAATGCCACTGAAGCGAGTTTTTGTCTCTACCGATGCTTCCGATTTTGCAAGCGGTGCC
GTCCTCTCTTTTGGCGAGACTTTTGAAACCGCGCGACCTGTGGCTTTTGAATCTAAGTCGTTCAAGGGTGCTGAA
CTTAACTATCCGGTCCACGAGAAGGAGCTTTTTGCAATTGTTAGAGCACTCGAAAAATGGCGGGTCGACCTGCTT
GGCGTACCTTTTACGGTCCTCACTGACCACCGGACACTCGAGTGTTTCAACACACAACGGCACTTATCCCGTCGC
CAAGCCCGGTGGATGGAGTTTCTACAACAATACGATTTCAGCATTGTTTATCTTCGAGGTGAAGACAATGTCGCC
GCCGACGCGTTATCACGGACCACATTTACAAATGCAATTTCCGAGCAAGATGCTTTCCATATGTCCCCCTGTGAT
CGTTTGGATGAACTGGACATTTCAGTGTGTGCGACATTGGACAATGCACTCACACCTCAAGCGGAATGGGCTGCC
ATGCTGTCCCTCCTCCCTAACGACACTATTGCCCACACGCTTGATATCGCAGCTGATGATGAGCTTCGTGACTCT
ATTCTTGCTGGCTACACAAACGATACATGGTGCACGAAACTACTGGCCACTTGGCAACAAATGCACAATGTGGTG
TTGCGCGGTGGTTTGCTGTTTTTCGAAGATCGTCTCATCATCCCCCGTACCGGGAACGTACGGGAAACAATATTC
GCCCTCGCTCATGATTCTTTGGGTCACTTCGGGCTCGATAAATCCTACGAGGCGCTACGTGGCTCGTTTTACTGG
CCTGGAATGCACACGGATCTGGAAAAATTGTACGTGCCTAAATGTGCACAATGTCAACGAATGAAATCTTCCACG
AAGAAACCTATCGGTCCTCTGCATCCCCTTCCCATACCTGACCATCGTTTCCAAGCGGTTGCTATCGATTTCGTT
GGGCCATTGCCTGAGGAACTTGGATTCAATTGTATCTTCACGATGACCGACCGCCTTGGAGCCGATGTTCGCCTT
GTCCCGACCACCATGAACGCTACAGCTGTGGATACCGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAATGGT
TTACCTCAAGAAATTGTATCTGATCGAGACAAATTGTTCACATCCTCCTTTTGGCGTTCACTCCACGAATTAACT
GGTACCGCTTTGAAAATGTCTACATCGTTCCATCCACAGACTGATGGTGCCAGCGAACGTACCAATAAAACTCTG
AACCAGTGTCTGCGCATGCATGTTGACAGCATGCAGCGAGGATGGGTTAAAGCCTTACCAGCTATCCGGTTCGCT
ATGATGAATACTCAGAACGCCTCAACTGGGCTCACGGGTTTCCAACTCCGTATGGGTTGCTCACCTCGAGTAATT
CCGCCTATCTACCGTGATAACTCTGATTTGCCCACCGAGTCTCCCGAAGATTTCCTGTTCAGAGTCTCTTCGTTA
GAAGCACAAGCTCGAGACACATTGTTACAGCATAAAGTCCTCCAGGCTCACCAAGCTAACAAACATCGCGATACA
TCTCCTTTCCCATTCGTTGTGGGTGGGCGAGTGAAGTTGTCTACTGCAAATCGACGCAAAAAGCTCTCCGTCGAA
GGAGCGAAACGTGTTGCTAAGCTCATGCCTCGGTTTGAAGGACCCTATGTGATTAGAGCTGTAAACGAAGAAAAC
AGTACTGTCACGTTGGAAATCCCGCGACGGGGTCATCATAATGGTACGGAATCGTTTCATACATCCCTTGTTCGT
CAATGGGTGGAAGACGACGCGCAAGTTTTCGACCGACCACCTCTCAACGACGCCGGAGAAGCTGAGGTGGAAGAA
ATAGTGGAGCGTCGAAAGATTGGTCGCGGTTGGAGTTACCGTGTGAAATACAGGGGTTACCCCGAAGAAGAGAAC
CAATGGTTACCTGGCAGAGAAGTCGAGAATCTTGAAGCACTCGACCGCTTTTTCGCCCGTGAAGGTCTTACAGAA
CTGGGACAGACCGTTTCATTGTCATCTGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail