Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|748000
Gene name
Locationscaffold_11:182244..182765
Strand+
Gene length (bp)521
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 2.8E-10 44 122

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|748000
MLVPRFRIPGILFFIGKHFGTGGRCFHWFFHDVPRLICPQIPKGVILATACIHLLQDSFGALQKGPAEEHFGNIG
DYTGLIILVSLLSILLIEYFCDSYVEHLHSEPPQPPSPEKSQESSIERSPHPAFSPSTAVT*
Coding >Agabi119p4|748000
ATGCTAGTCCCCCGTTTTCGGATACCTGGCATCCTTTTCTTCATTGGAAAACACTTTGGTACAGGTGGGCGTTGT
TTTCATTGGTTTTTTCACGATGTCCCGAGATTGATCTGCCCGCAAATTCCAAAAGGTGTTATCCTGGCCACTGCG
TGTATCCATTTGCTCCAAGACTCGTTTGGAGCCCTCCAAAAAGGCCCGGCCGAAGAGCATTTTGGTAATATCGGA
GACTATACAGGCCTCATCATTCTTGTATCTCTCCTCAGCATTTTGCTTATTGAATATTTTTGCGATTCTTATGTT
GAACATCTACACTCAGAACCGCCCCAACCGCCTTCACCCGAAAAATCTCAAGAATCTTCCATAGAACGCTCACCG
CATCCCGCTTTCTCGCCCTCGACAGCAGTAACATAA
Transcript >Agabi119p4|748000
ATGCTAGTCCCCCGTTTTCGGATACCTGGCATCCTTTTCTTCATTGGAAAACACTTTGGTACAGGTGGGCGTTGT
TTTCATTGGTTTTTTCACGATGTCCCGAGATTGATCTGCCCGCAAATTCCAAAAGGTGTTATCCTGGCCACTGCG
TGTATCCATTTGCTCCAAGACTCGTTTGGAGCCCTCCAAAAAGGCCCGGCCGAAGAGCATTTTGGTAATATCGGA
GACTATACAGGCCTCATCATTCTTGTATCTCTCCTCAGCATTTTGCTTATTGAATATTTTTGCGATTCTTATGTT
GAACATCTACACTCAGAACCGCCCCAACCGCCTTCACCCGAAAAATCTCAAGAATCTTCCATAGAACGCTCACCG
CATCCCGCTTTCTCGCCCTCGACAGCAGTAACATAA
Gene >Agabi119p4|748000
ATGCTAGTCCCCCGTTTTCGGATACCTGGCATCCTTTTCTTCATTGGAAAACACTTTGGTACAGGTGGGCGTTGT
TTTCATTGGTTTTTTCACGATGTCCCGAGATTGATCTGCCCGCAAATTCCAAAAGGTGTTATCCTGGCCACTGCG
TGTATCCATTTGCTCCAAGACTCGTTTGGAGCCCTCCAAAAAGGCCCGGCCGAAGAGCATTTTGGTAATATCGGA
GACTATACAGGCCTCATCATGTACGTGCGGTATCCTGTCTGCACGCGGCCTATACGACCCTGACGATATTTTAAA
TTAGTCTTGTATCTCTCCTCAGCATTTTGCTTATTGAATGTCCGTATCTCAAATCTTTTCGAACTATTATTCGTT
GAATCGTTATCTTAGATTTTTGCGATTCTTATGTTGAACATCTACACTCAGAACCGCCCCAACCGCCTTCACCCG
AAAAATCTCAAGAATCTTCCATAGAACGCTCACCGCATCCCGCTTTCTCGCCCTCGACAGCAGTAACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail