Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|747000
Gene name
Locationscaffold_11:55137..56523
Strand-
Gene length (bp)1386
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.8E-14 37 301

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99289|HLT_VIBPA Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0226 PE=1 SV=2 63 305 1.0E-10
sp|Q9FJ25|GDL81_ARATH GDSL esterase/lipase At5g41890 OS=Arabidopsis thaliana GN=At5g41890 PE=3 SV=1 67 305 5.0E-08
sp|Q9FHQ1|GDL80_ARATH GDSL esterase/lipase At5g37690 OS=Arabidopsis thaliana GN=At5g37690 PE=2 SV=1 82 300 6.0E-06

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|747000
MVLPPLNFAEMYAKVVASLVLTPLASHGLDIPFRNMFAFGDSYTTNGWNGNGDPTAPHSSVCFSGGPPWSVQFTE
MTEMNLVDLAIAGAAVDNSIIFTGPLDFVGQTTTFLEQVAPFPDKVTWNSSDSLFTVSFGTNDVNNSFRNTNDTG
TQLYSQVMDTYFTTVDRLYAAGARNFVFNNVVPFDRAQIGVGQGPELQEKLKQSILEFNAQLESSADAYCNSKSD
IDTCVIFDTHTLFADLMDHPDNFGFESADGFCQSYANKFNCDIDPTVDPTCLGPLAVYVWKDTLHPSYAADTFWA
QGVIDEL*
Coding >Agabi119p4|747000
ATGGTATTACCACCGTTGAACTTTGCTGAGATGTATGCAAAGGTAGTTGCATCGTTAGTACTTACACCTCTGGCC
TCTCATGGCCTTGATATTCCATTTCGGAATATGTTCGCCTTCGGTGACAGCTACACAACAAACGGTTGGAACGGA
AATGGTGACCCTACTGCCCCTCATAGTTCTGTCTGCTTCTCTGGCGGTCCTCCTTGGTCGGTTCAATTCACTGAA
ATGACAGAAATGAATCTTGTCGATCTCGCAATAGCCGGCGCTGCGGTTGATAACAGCATAATTTTCACAGGACCT
CTCGATTTCGTAGGTCAGACTACGACCTTCCTGGAACAGGTCGCGCCTTTCCCCGATAAAGTAACGTGGAACAGC
AGCGATTCGTTGTTCACTGTCTCATTCGGAACCAACGACGTGAATAATTCGTTCAGAAATACAAACGACACTGGA
ACACAGCTCTACAGCCAAGTGATGGATACGTATTTCACCACTGTGGATAGGTTATACGCCGCCGGAGCGCGTAAT
TTCGTGTTCAACAACGTTGTTCCGTTCGATAGGGCACAAATTGGGGTTGGACAGGGCCCAGAGCTCCAGGAAAAG
CTGAAGCAAAGTATACTTGAATTCAATGCTCAACTTGAATCAAGCGCAGACGCATATTGCAATTCGAAGTCCGAT
ATCGACACCTGCGTTATTTTTGACACCCACACGCTCTTTGCCGATCTGATGGACCACCCAGATAACTTCGGGTTC
GAGAGTGCCGACGGTTTTTGCCAATCGTATGCGAATAAATTCAATTGTGATATTGACCCCACGGTTGATCCCACT
TGTCTGGGTCCATTGGCCGTTTACGTTTGGAAGGATACGCTCCATCCTTCCTATGCGGCAGACACGTTCTGGGCG
CAAGGAGTGATTGACGAGTTATAA
Transcript >Agabi119p4|747000
ATGGTATTACCACCGTTGAACTTTGCTGAGATGTATGCAAAGGTAGTTGCATCGTTAGTACTTACACCTCTGGCC
TCTCATGGCCTTGATATTCCATTTCGGAATATGTTCGCCTTCGGTGACAGCTACACAACAAACGGTTGGAACGGA
AATGGTGACCCTACTGCCCCTCATAGTTCTGTCTGCTTCTCTGGCGGTCCTCCTTGGTCGGTTCAATTCACTGAA
ATGACAGAAATGAATCTTGTCGATCTCGCAATAGCCGGCGCTGCGGTTGATAACAGCATAATTTTCACAGGACCT
CTCGATTTCGTAGGTCAGACTACGACCTTCCTGGAACAGGTCGCGCCTTTCCCCGATAAAGTAACGTGGAACAGC
AGCGATTCGTTGTTCACTGTCTCATTCGGAACCAACGACGTGAATAATTCGTTCAGAAATACAAACGACACTGGA
ACACAGCTCTACAGCCAAGTGATGGATACGTATTTCACCACTGTGGATAGGTTATACGCCGCCGGAGCGCGTAAT
TTCGTGTTCAACAACGTTGTTCCGTTCGATAGGGCACAAATTGGGGTTGGACAGGGCCCAGAGCTCCAGGAAAAG
CTGAAGCAAAGTATACTTGAATTCAATGCTCAACTTGAATCAAGCGCAGACGCATATTGCAATTCGAAGTCCGAT
ATCGACACCTGCGTTATTTTTGACACCCACACGCTCTTTGCCGATCTGATGGACCACCCAGATAACTTCGGGTTC
GAGAGTGCCGACGGTTTTTGCCAATCGTATGCGAATAAATTCAATTGTGATATTGACCCCACGGTTGATCCCACT
TGTCTGGGTCCATTGGCCGTTTACGTTTGGAAGGATACGCTCCATCCTTCCTATGCGGCAGACACGTTCTGGGCG
CAAGGAGTGATTGACGAGTTATAA
Gene >Agabi119p4|747000
ATGGTATTACCACCGTTGAACTTTGCTGAGATGTATGCAAAGGTAGTTGCATCGTTAGTACTTACACCTCTGGCC
TCTCATGGCCTTGATATTCCATTTCGGAATATGTTCGCCTTGTGCGTATTTCTTCTGCTCATTTAGCTCTGTGCA
CACATATGAAATCTCTGTTCTAGCGGTGACAGGTGTGACGATCCATAATGATTTGGACGCAGCATAATTTTTATC
ATAACTAAACATTACTACCATTCAACAGCTACAGTTAGTGTTCCATAGTATTTCCTCGTATGCAATTGTCGGACT
GAATATATTCTTCAACAGCAACAAACGGTTGGAACGGAAATGGTGACCCTACTGCCCCTCATAGTTCTGTCTGCT
TCTCTGGCGGTCCTCCTTGGTCGGTTCAATTCACTGAAATGACAGAAATGAATCTTGTCGATGTAGGTTCTGGCT
CGTAATTTAGAGCTATACTGACAAGTTGAATTTCGTTCAGCTCGCAATAGCCGGCGCTGCGGTTGATAACAGCAT
AATTTTCACAGGACCTCTCGATTTCGTAGGTCAGACTACGACCTTCCTGGAACAGGTCGCGCCTTTCCCCGATAA
AGTAACGTGGAACAGCAGCGATTCGTTGTTCACTGTCTCATTCGGAAGTTGAGCCTATTTTACATCTATTAATGG
ACAAGCAACTGATTGCTCGTATTAGCCAACGACGTGAATAATTCGTTCAGAAATACAAACGACACTGGAACACAG
CTCTACAGCCAAGTGATGGATACGTATTTCACCACTGTGGATAGGTTATACGCCGCCGGAGCGCGTAATTTCGTG
TTCAACAACGTTGTTCCGTTCGATAGGGCACAAATTGGGGTTGGACAGGGCCCAGAGCTCCAGGAAAAGCTGAAG
GTACTCTTCTGACGATCTGAAAAAATCACAGGATTAGTCGACTAACATCTAGCAGCAAAGTATACTTGAATTCAA
TGCTCAACTTGAATCAAGCGCAGACGCATATTGCAATTCGAAGTCCGATATCGACACCTGCGTTATTTTTGACAC
CCGTACGAGCTATTGTCCTCTATCCGTCACTCTATGATACTCACGTTTGAATGAAATCGACCAGACACGCTCTTT
GCCGATCTGATGGACCACCCAGATAACTTCGGGTTCGAGAGTGCCGACGGTTTTTGCCAATCGTATGCGAATAAA
TTCAATTGTGATATTGACCCCACGGTTGATCCCACTTGTCTGGGTCCATTGGCCGTTTGTGAGTGATTAGTTGAA
TTGAAAGAAACAGGGCATAATCTATTCTCCTTAGACGTTTGGAAGGATACGCTCCATCCTTCCTATGCGGCAGAC
ACGTTCTGGGCGCAAGGAGTGATTGACGAGTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail