Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|739350
Gene name
Locationscaffold_10:1224735..1226621
Strand-
Gene length (bp)1886
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08288 PIGA PIGA (GPI anchor biosynthesis) 7.2E-37 45 133
PF00534 Glycos_transf_1 Glycosyl transferases group 1 3.5E-25 199 347
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 1.7E-24 17 163
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 6.2E-22 211 346
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 1.9E-09 18 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 8 434 1.0E-144
sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 6 434 4.0E-134
sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 6 434 1.0E-129
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 6 434 4.0E-126
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 6 434 8.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 8 434 1.0E-144
sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 6 434 4.0E-134
sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 6 434 1.0E-129
sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 6 434 4.0E-126
sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 6 434 8.0E-126
sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 6 434 8.0E-126
sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 6 434 8.0E-126
sp|Q8CWR6|AMGDS_STRR6 Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr0982 PE=1 SV=1 4 314 8.0E-16
sp|P9WMY9|GLGSY_MYCTU Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3032 PE=1 SV=1 187 394 2.0E-12
sp|P9WMY8|GLGSY_MYCTO Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3116 PE=3 SV=1 187 394 2.0E-12
sp|Q4H4F8|BTRM_BACCI 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Bacillus circulans GN=btrM PE=3 SV=1 211 350 2.0E-11
sp|Q81ST7|BSHA_BACAN N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus anthracis GN=bshA PE=1 SV=1 14 393 5.0E-11
sp|P42982|BSHA_BACSU N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus subtilis (strain 168) GN=bshA PE=1 SV=2 1 386 9.0E-11
sp|Q8NTA6|MSHA_CORGL D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=mshA PE=1 SV=1 4 321 3.0E-10
sp|A4QB40|MSHA_CORGB D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium glutamicum (strain R) GN=mshA PE=3 SV=1 4 321 3.0E-10
sp|Q59002|Y1607_METJA Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1607 PE=3 SV=1 4 386 4.0E-10
sp|D6Z995|MSHA_SEGRD D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) GN=mshA PE=3 SV=1 16 352 5.0E-10
sp|P0CF99|PIMC_MYCTO GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimC PE=1 SV=1 4 391 3.0E-09
sp|A5U3B9|PIMC_MYCTA GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pimC PE=3 SV=1 4 391 3.0E-09
sp|P71243|WCAL_ECOLI Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) GN=wcaL PE=3 SV=2 198 337 3.0E-09
sp|Q4JSW2|MSHA_CORJK D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=mshA PE=3 SV=1 4 381 5.0E-09
sp|Q8S4F6|SQD2_ARATH Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana GN=SQD2 PE=1 SV=1 212 384 9.0E-09
sp|Q8FSH1|MSHA_COREF D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=mshA PE=3 SV=1 4 369 1.0E-08
sp|A0QWG6|PIMA_MYCS2 GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pimA PE=1 SV=1 190 384 2.0E-08
sp|P9WMZ2|PIMB_MYCTO GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimB PE=3 SV=1 186 376 2.0E-08
sp|P9WMZ3|PIMB_MYCTU GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pimB PE=1 SV=1 186 376 2.0E-08
sp|P9WMZ0|GLGA_MYCTO Capsular glucan synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgA PE=3 SV=1 96 384 2.0E-08
sp|P9WMZ1|GLGA_MYCTU Capsular glucan synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgA PE=1 SV=1 96 384 2.0E-08
sp|Q53U18|NEOD_STRFR 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Streptomyces fradiae GN=neoD PE=1 SV=1 17 348 2.0E-08
sp|B1VEI4|MSHA_CORU7 D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=mshA PE=3 SV=1 4 395 3.0E-08
sp|Q9AET5|GTF1_STRGN Glycosyltransferase Gtf1 OS=Streptococcus gordonii GN=gtf1 PE=3 SV=2 203 310 5.0E-08
sp|A3PU84|MSHA_MYCSJ D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium sp. (strain JLS) GN=mshA PE=3 SV=1 16 339 7.0E-08
sp|Q65CC7|KANE_STRKN Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus GN=kanE PE=1 SV=1 24 324 9.0E-08
sp|Q8NNK8|PIMB_CORGL GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pimB PE=1 SV=1 190 324 9.0E-08
sp|Q58459|Y1059_METJA Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1059 PE=3 SV=1 182 324 2.0E-07
sp|Q93P60|AMGDS_ACHLA Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii GN=mgs PE=1 SV=1 4 313 2.0E-07
sp|C8XA09|MSHA_NAKMY D-inositol 3-phosphate glycosyltransferase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=mshA PE=3 SV=1 16 320 2.0E-07
sp|P54138|MSHA_MYCLE D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium leprae (strain TN) GN=mshA PE=3 SV=2 16 321 4.0E-07
sp|B8ZT88|MSHA_MYCLB D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium leprae (strain Br4923) GN=mshA PE=3 SV=1 16 321 4.0E-07
sp|Q6NJL3|MSHA_CORDI D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=mshA PE=3 SV=1 1 321 4.0E-07
sp|P9WMY4|MGTA_MYCTO GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mgtA PE=3 SV=1 1 330 6.0E-07
sp|P9WMY5|MGTA_MYCTU GDP-mannose-dependent alpha-mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mgtA PE=1 SV=1 1 330 6.0E-07
sp|P9WMZ5|PIMA_MYCTU GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pimA PE=1 SV=1 190 387 8.0E-07
sp|P9WMZ4|PIMA_MYCTO GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pimA PE=3 SV=1 190 387 8.0E-07
sp|Q7TY88|PIMA_MYCBO GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pimA PE=3 SV=1 190 387 8.0E-07
sp|Q3S2Y2|GTF1_STRAG Glycosyltransferase Gtf1 OS=Streptococcus agalactiae GN=gtf1 PE=1 SV=1 133 317 8.0E-07
sp|C4LLD6|MSHA_CORK4 D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=mshA PE=3 SV=1 16 321 1.0E-06
sp|P26388|WCAL_SALTY Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wcaL PE=3 SV=1 203 337 1.0E-06
sp|Q9L1I4|Y2592_STRCO Exopolysaccharide phosphotransferase SCO2592 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2592 PE=3 SV=1 189 385 1.0E-06
sp|A4FQ08|MSHA_SACEN D-inositol 3-phosphate glycosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=mshA PE=3 SV=1 16 321 2.0E-06
sp|P54490|YQGM_BACSU Uncharacterized glycosyltransferase YqgM OS=Bacillus subtilis (strain 168) GN=yqgM PE=3 SV=2 182 319 2.0E-06
sp|Q1BEA6|MSHA_MYCSS D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium sp. (strain MCS) GN=mshA PE=3 SV=1 16 339 2.0E-06
sp|A1UAM8|MSHA_MYCSK D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium sp. (strain KMS) GN=mshA PE=3 SV=1 16 339 2.0E-06
sp|Q58577|Y1178_METJA Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1178 PE=3 SV=1 86 381 2.0E-06
sp|A0R043|PIMB_MYCS2 GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pimB PE=1 SV=1 212 389 6.0E-06
sp|A0QQZ8|MSHA_MYCS2 D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mshA PE=1 SV=1 16 339 9.0E-06
sp|C7QKE8|MSHA2_CATAD D-inositol 3-phosphate glycosyltransferase 2 OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=mshA2 PE=3 SV=1 16 386 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016757 glycosyltransferase activity Yes
GO:0008610 lipid biosynthetic process No
GO:0019538 protein metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006650 glycerophospholipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0046467 membrane lipid biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0006664 glycolipid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0006497 protein lipidation No
GO:0036211 protein modification process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043412 macromolecule modification No
GO:0006643 membrane lipid metabolic process No
GO:0009987 cellular process No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:0046486 glycerolipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 406 428 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|739350
MEKLAIAMISDFFHPNVGGVENHIYMLSTELIRRGHKVIVITHAHKPDRVGIRWLLPSLKVYYIPFIPIASSATL
PNFFTSLPYLRTILLREHIHLIHAHASLSSIGHEGILHSHLMGIRTVFTDHSLFGFEDSASILTNKLLVATLKNV
DAVICVSHTGRENTVLRGQLFEKDQNDPTKLSVRRSVYVIPNALVAEQFKPRPPEPSEFITIVVISRLAYRKGID
LLVATAPRICAAFPNVRFVVGGDGPKLIDLLQMREKYSLQDRVELLGAIRHSDVVSVLSRGTIFMNTSLTESFGI
AILEAACAGLYVVSTRVGGVPEILPQDMISFAEPDADDVYRAISEAITLVAAGKHDPMKAHERLKTFYDWRLVAA
RTEKVYTAVVQSPQMGLVERIQRTMDLGPCVGPIYTIILLVDCIFFLVLEWFYPREDLDYVEHHWDDDALTQLQS
LSYSRES*
Coding >Agabi119p4|739350
ATGGAGAAGCTTGCAATTGCCATGATATCGGACTTCTTTCATCCCAATGTTGGAGGTGTAGAGAACCATATTTAC
ATGTTAAGTACGGAGTTAATAAGACGTGGTCACAAGGTTATAGTGATAACCCACGCACATAAACCAGACCGCGTC
GGCATTCGCTGGCTTCTTCCATCGCTCAAAGTCTACTATATACCCTTTATACCCATTGCATCCTCGGCCACACTC
CCAAACTTCTTCACTTCACTACCGTATCTTAGAACTATCCTCTTACGCGAACACATACACTTAATTCATGCTCAT
GCCAGCTTATCCTCGATTGGACATGAAGGCATTCTACATTCGCACCTCATGGGTATTCGGACAGTCTTCACTGAT
CACAGTCTCTTCGGCTTCGAAGATTCAGCAAGCATTTTGACCAACAAACTTCTTGTCGCTACTCTCAAAAACGTG
GATGCGGTCATCTGCGTCTCACATACCGGGCGGGAAAATACTGTTCTACGAGGGCAACTATTCGAGAAAGACCAA
AACGATCCTACCAAGCTCTCTGTTCGACGAAGTGTTTACGTAATCCCTAATGCGCTCGTCGCGGAGCAATTCAAG
CCACGCCCGCCAGAGCCTAGCGAATTCATCACTATTGTCGTTATCTCCAGGCTAGCCTACCGAAAAGGCATCGAC
TTACTTGTAGCAACTGCTCCTCGTATTTGCGCTGCATTTCCCAATGTAAGATTCGTCGTTGGCGGTGATGGTCCC
AAGTTGATTGATCTTCTCCAGATGCGGGAGAAATATTCTTTGCAAGATCGTGTCGAATTACTAGGCGCAATACGT
CATAGTGATGTCGTTTCGGTCTTGTCCCGCGGTACAATATTCATGAACACATCCTTGACAGAATCATTTGGCATA
GCCATTCTCGAAGCTGCTTGCGCCGGTTTGTACGTCGTATCTACTCGGGTCGGAGGAGTACCAGAAATTTTACCA
CAAGACATGATCAGTTTTGCTGAGCCAGACGCAGACGATGTCTACCGTGCTATCTCAGAAGCCATTACACTGGTC
GCAGCAGGAAAACATGACCCGATGAAAGCCCACGAACGCCTGAAGACTTTTTATGATTGGCGCTTGGTTGCCGCA
AGGACCGAAAAAGTATACACCGCCGTCGTTCAGTCGCCTCAAATGGGATTAGTGGAACGCATACAAAGGACAATG
GATTTAGGTCCTTGTGTAGGACCCATATATACGATAATCCTGTTAGTTGATTGCATTTTCTTCTTGGTGTTGGAA
TGGTTTTATCCAAGAGAGGATCTGGATTACGTAGAGCATCATTGGGATGATGATGCACTTACCCAGCTTCAGTCC
CTGTCGTATAGTAGGGAGAGTTAA
Transcript >Agabi119p4|739350
ATGGAGAAGCTTGCAATTGCCATGATATCGGACTTCTTTCATCCCAATGTTGGAGGTGTAGAGAACCATATTTAC
ATGTTAAGTACGGAGTTAATAAGACGTGGTCACAAGGTTATAGTGATAACCCACGCACATAAACCAGACCGCGTC
GGCATTCGCTGGCTTCTTCCATCGCTCAAAGTCTACTATATACCCTTTATACCCATTGCATCCTCGGCCACACTC
CCAAACTTCTTCACTTCACTACCGTATCTTAGAACTATCCTCTTACGCGAACACATACACTTAATTCATGCTCAT
GCCAGCTTATCCTCGATTGGACATGAAGGCATTCTACATTCGCACCTCATGGGTATTCGGACAGTCTTCACTGAT
CACAGTCTCTTCGGCTTCGAAGATTCAGCAAGCATTTTGACCAACAAACTTCTTGTCGCTACTCTCAAAAACGTG
GATGCGGTCATCTGCGTCTCACATACCGGGCGGGAAAATACTGTTCTACGAGGGCAACTATTCGAGAAAGACCAA
AACGATCCTACCAAGCTCTCTGTTCGACGAAGTGTTTACGTAATCCCTAATGCGCTCGTCGCGGAGCAATTCAAG
CCACGCCCGCCAGAGCCTAGCGAATTCATCACTATTGTCGTTATCTCCAGGCTAGCCTACCGAAAAGGCATCGAC
TTACTTGTAGCAACTGCTCCTCGTATTTGCGCTGCATTTCCCAATGTAAGATTCGTCGTTGGCGGTGATGGTCCC
AAGTTGATTGATCTTCTCCAGATGCGGGAGAAATATTCTTTGCAAGATCGTGTCGAATTACTAGGCGCAATACGT
CATAGTGATGTCGTTTCGGTCTTGTCCCGCGGTACAATATTCATGAACACATCCTTGACAGAATCATTTGGCATA
GCCATTCTCGAAGCTGCTTGCGCCGGTTTGTACGTCGTATCTACTCGGGTCGGAGGAGTACCAGAAATTTTACCA
CAAGACATGATCAGTTTTGCTGAGCCAGACGCAGACGATGTCTACCGTGCTATCTCAGAAGCCATTACACTGGTC
GCAGCAGGAAAACATGACCCGATGAAAGCCCACGAACGCCTGAAGACTTTTTATGATTGGCGCTTGGTTGCCGCA
AGGACCGAAAAAGTATACACCGCCGTCGTTCAGTCGCCTCAAATGGGATTAGTGGAACGCATACAAAGGACAATG
GATTTAGGTCCTTGTGTAGGACCCATATATACGATAATCCTGTTAGTTGATTGCATTTTCTTCTTGGTGTTGGAA
TGGTTTTATCCAAGAGAGGATCTGGATTACGTAGAGCATCATTGGGATGATGATGCACTTACCCAGCTTCAGTCC
CTGTCGTATAGTAGGGAGAGTTAA
Gene >Agabi119p4|739350
ATGGAGAAGCTTGCAATTGCGTACGTGCCAAAATTTTCTACAATGACGTGTAGCTTACACTGGAAAATGTCAGCA
TGATATCGGACTTCTTTCATCCCAATGTTGGAGGTGTAGAGAACCATATTTACATGTTAAGTACGGAGTTAATAA
GACGTGGTCACAAGGTACGTTCTGCAATCCTTTAGGATGAAAGCTCACATATCTGAGGTGGACCTACACAAAGGT
TATAGTGATAACCCACGCACATAAACCAGACCGCGTCGGCATTCGCTGGCTTCTTCCATCGCTCAAAGTCTACTA
TATACCCTTTATACCCATTGCATCCTCGGCCACACTCCCAAACTTCTTCACTTCACTACCGTATCTTAGAACTAT
CCTCTTACGCGAACACATACACTTAATTCATGCTCATGCCAGCTTATCCTCGATTGGACATGAAGGCATTCTACA
TTCGCACCTCATGGGTATTCGGACAGTCTTCACTGATCACAGTCTCTTCGGCTTCGAAGATTCAGCAAGCATTTT
GACCAACAAACTTCTTGTCGCTACTCTCAAAAACGTGGATGCGGTCATCTGCGTCTCACATACCGGGTTCGTACT
CACTCATTGCGTATTGTATCAGCTAAATAATATATACAGGCGGGAAAATACTGTTCTACGAGGGCAACTATTCGA
GAAAGACCAAAACGATCCTACCAAGCTCTCTGTTCGACGAAGTGTTTACGTAATCCCTAATGCGCTCGTCGCGGA
GCAATTCAAGCCACGCCCGCCAGAGCCTAGCGAATTCAGTGCGTTTCTCCGCGCCCAATCATAGGTGACATAAAT
GGCTAACGTTTATCCTTAGTCACTATTGTCGTTATCTCCAGGCTAGCCTACCGAAAAGGCATCGACTTACTTGTA
GCAACTGCTCCTCGTATTTGCGCTGCATTTCCCAATGTAAGATTCGTCGTTGGTAAGTCACCTGTCTGCATAAAG
ATGAAAATTCTTGAGTCCACGGAGAAGCTAACAAACAAAATAGGCGGTGATGGTCCCAAGTTGATTGATCTTCTC
CAGATGCGGGAGAAATATTCTTTGCAAGATCGTGTCGAATTACTAGGCGCAATACGTCATAGTGATGTCGTTTCG
GTGAGTAAACCCATCAAAATTCACTTCTCAACTCAACTCAAATCTCTGAGCAATAGGTCTTGTCCCGCGGTACAA
TATTCATGAACACATCCTTGACAGAATCATTTGGCATAGCCATTCTCGAAGCTGCTTGCGCCGGTTTGTACGTCG
TATCTACTCGGGTCGGAGGAGTACCAGAAATTTTACCACAAGACATGATCAGTTTTGCTGAGCCAGACGCAGACG
GTATGTATATGGTCCCCTTCTCATTGAAGTTTGTATTGCCTCAATGTAGCTTCATGAGTTACGGGACCCACGAAC
ATGGAACTACGAAAACTGATTTAGAAAAATATTTCTCTTCTCTTCTTGACAGATGTCTACCGTGCTATCTCAGAA
GCCATTACACTGGTCGCAGCAGGAAAACATGACCCGATGAAAGCCCACGAACGCCTGAAGACTTTTTATGATTGG
CGCTTGGTTGCCGCAAGGACCGAAAAAGTATACACCGCCGTCGTTCAGTCGCCTCAAATGGGATTAGTGGAACGC
ATACAAAGGTACGTCGAGATGGTTTGTGTCGTGGCGGAAAATTAATTTCCATTAGGACAATGGATTTAGGTCCTT
GTGTAGGACCCATATATACGATAATCCTGTTAGTTGATTGCATTTTCTTCTTGGTGTTGGAATGGTTTTATCCAA
GAGAGGATCTGGATTACGTAGAGCATCATTGGGATGATGATGCACTTACCCAGCTTCAGTCCCTGTCGTATAGTA
GGGAGAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail