Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|737400
Gene name
Locationscaffold_10:1104508..1108308
Strand-
Gene length (bp)3800
Transcript length (bp)2826
Coding sequence length (bp)2826
Protein length (aa) 942

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19501 YetA YetA-like protein 2.0E-303 6 891

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O31530|YETA_BACSU Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) GN=yetA PE=4 SV=2 7 893 9.0E-145

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|737400
MTSPSARVHWLDGSPPAFTPSGTAFGIPWSQGEIDRTTPLKIRSSSTSLPLQSWPLAYWPDGTLKWSGHALPANL
ATDSSELIVSPGTPTEPESPVSVTHDGDATIVSTGPFSVRFNAPGSTSLISSIVLNGKTLAQNATLVLHVQNAPD
PDLTLVRTGITQFPDVQSMNGKIDTVQVEQEGPVRAVIKMTGKYTATTGGEHADFLPFTLRFYISSGATTLRMVH
FFIYDGDQTKDFIKGLGLTFSTPMSDQLHDRHIRFLSSPFPNASASKPDASDSGVAGVWGEAARVVSGLRRDATA
PVLNAQFNGTPTPPLNTWPSNVTAGLDDLPAWSDYSLDQLSPSYFSISKRTNASTKANWVSHAGHGTRAAGLGYV
GGATNGGVVFGLRDFWQGAPRSLHIRNAAEDVANVTLWAWSPQAPAMDMRHYDTVPHGLDLTYEDVGNPDPTPIG
IGRSYEITLQLFSATPSRSDLAKLADVHTRVPQLVSTPKFYASKKLFGGRWDLPDTTRSGAAIIEKQKSDLLDFY
IKDIDQRQFYGFWNYGDVMHTYDQTRHEWRYDIGGFAWDNGELGTDLWLWLSFLRTGRADVFRIASALTRHLSET
DTHHTGPLAGLGSRHNVSHWGDGAKEARVSGSWLRRPFYFITTDELMGDMMDLTLQADQTIMEWDPLRKVLPPPP
PEGPGRLRIGPDWNALAGNWFTKWERTMDNQWLERMKIGMRDIGSFKFGLFTGDGSAVGWNADTAHLVDEGGEGK
SSYHLMMLFGGGEFLMEAMDLTVIRDDVPEFDAAWLDFCRLFNGTNDEKIARYGKAFSSGGFQQLYAKLQAYVGQ
RLNQTELQERAWDFLNGNTTGVYPPAVSVGGTDVLNPIMEIVNLATNDAAHLSLSQYAVLAIAPDLAPNEVWDSQ
EGDEATIVNFDKNILKLPGDSDLPKQRQRSSGKWKKLLCMS*
Coding >Agabi119p4|737400
ATGACTTCACCAAGTGCTCGCGTACATTGGCTTGATGGATCCCCTCCAGCTTTTACCCCTTCTGGGACGGCCTTT
GGTATTCCCTGGTCTCAAGGGGAAATTGATCGCACAACGCCACTGAAGATTCGATCGTCTTCTACAAGTCTCCCT
TTGCAGAGTTGGCCACTCGCATACTGGCCGGATGGTACTCTGAAATGGTCTGGGCATGCGCTTCCGGCGAATCTG
GCCACCGACTCGTCAGAGCTAATCGTGTCACCTGGGACTCCGACTGAGCCTGAATCACCCGTCTCGGTAACACAT
GATGGCGATGCTACGATAGTCTCAACAGGACCTTTCTCAGTTCGGTTTAATGCGCCTGGTTCAACGAGTTTAATA
TCTTCGATCGTTTTGAATGGTAAAACTCTCGCTCAAAATGCAACTCTCGTCCTCCATGTCCAGAATGCCCCGGAT
CCTGATCTAACACTCGTTCGAACTGGTATCACACAATTTCCTGATGTCCAGAGTATGAATGGTAAGATCGATACT
GTTCAAGTTGAACAAGAAGGCCCCGTCCGCGCTGTAATCAAAATGACGGGTAAATACACAGCGACAACGGGTGGT
GAACATGCCGATTTTCTTCCGTTCACTCTACGCTTTTATATCTCTTCTGGGGCTACAACGCTCCGAATGGTTCAC
TTTTTCATATACGATGGTGACCAGACCAAAGATTTCATCAAGGGCCTTGGCCTGACTTTTTCGACACCAATGTCG
GACCAACTCCATGACAGACACATTCGGTTCCTGTCCTCCCCATTTCCCAATGCATCTGCATCCAAGCCAGACGCG
TCTGATTCAGGAGTAGCCGGTGTTTGGGGTGAAGCGGCACGTGTTGTTTCCGGGCTTCGTCGGGACGCCACCGCT
CCGGTTCTTAATGCTCAATTCAATGGGACGCCTACCCCACCTCTCAATACGTGGCCATCGAATGTAACTGCCGGG
CTTGATGACTTGCCGGCATGGTCAGACTATTCGCTTGACCAACTCTCTCCGTCATATTTCTCCATCAGTAAACGT
ACAAACGCAAGTACCAAGGCGAACTGGGTTAGTCATGCTGGTCATGGAACGCGAGCAGCAGGATTGGGCTATGTA
GGAGGCGCTACAAATGGAGGAGTGGTTTTTGGATTGCGAGATTTCTGGCAAGGTGCCCCTAGGAGTTTACATATT
AGAAATGCGGCGGAGGATGTAGCAAATGTGACACTTTGGGCATGGAGTCCTCAGGCTCCAGCCATGGATATGCGA
CATTATGATACAGTTCCTCACGGGCTTGACCTCACATATGAGGACGTGGGTAATCCGGACCCCACTCCTATCGGA
ATCGGAAGGTCATACGAAATAACTTTGCAACTCTTCTCAGCCACACCAAGCCGATCCGATTTAGCAAAACTGGCG
GATGTACATACCCGCGTCCCTCAGCTTGTTTCCACACCTAAGTTTTATGCGTCCAAGAAATTGTTTGGTGGTCGA
TGGGATTTACCTGATACAACGCGAAGTGGCGCTGCGATAATTGAGAAACAGAAAAGCGATCTTTTGGATTTCTAC
ATCAAGGATATTGACCAGAGACAGTTCTACGGATTCTGGAATTATGGTGATGTCATGCATACTTACGATCAAACG
AGGCATGAATGGCGATATGATATTGGCGGATTTGCTTGGGACAATGGTGAACTCGGAACAGATCTGTGGCTTTGG
CTCTCCTTCCTCCGTACAGGCCGTGCAGACGTCTTCCGCATCGCATCGGCTTTGACACGCCATCTTTCTGAGACG
GATACGCATCACACTGGTCCGTTGGCTGGACTTGGCTCAAGGCACAACGTTAGTCATTGGGGAGATGGTGCCAAA
GAGGCACGAGTTTCTGGAAGCTGGTTGAGAAGACCATTTTATTTTATCACGACGGACGAGCTCATGGGAGATATG
ATGGATCTGACGCTTCAAGCTGACCAGACGATCATGGAATGGGATCCACTACGAAAGGTTTTACCACCTCCACCC
CCTGAAGGACCTGGTCGACTCAGGATTGGACCTGACTGGAATGCTTTAGCCGGTAATTGGTTTACCAAGTGGGAG
AGAACTATGGACAACCAGTGGCTTGAGAGGATGAAGATCGGCATGAGAGATATAGGAAGCTTCAAGTTCGGATTA
TTCACGGGAGATGGATCAGCTGTGGGTTGGAATGCTGATACAGCACACTTGGTAGATGAGGGCGGGGAAGGCAAA
AGCTCGTATCACCTCATGATGCTTTTTGGAGGCGGTGAATTCCTGATGGAAGCCATGGATCTGACCGTTATTCGC
GATGATGTACCGGAGTTCGATGCTGCCTGGTTGGATTTCTGCCGTCTCTTTAATGGTACGAACGATGAGAAAATC
GCGAGGTATGGGAAAGCATTTTCAAGTGGAGGTTTTCAGCAGCTTTATGCTAAGCTGCAAGCTTATGTGGGTCAA
CGCTTGAATCAGACTGAGCTCCAAGAACGGGCTTGGGACTTTTTGAATGGGAATACCACCGGTGTATATCCACCT
GCTGTCTCAGTCGGCGGAACAGATGTGCTGAACCCTATCATGGAGATTGTGAATTTAGCTACCAACGATGCTGCC
CATCTCTCTCTTTCTCAATACGCGGTTCTTGCAATTGCGCCAGACTTAGCCCCAAATGAGGTGTGGGACTCACAA
GAAGGGGACGAGGCGACCATAGTCAATTTTGATAAAAATATTCTCAAGCTTCCTGGGGACTCGGACTTACCGAAA
CAGAGACAGAGGTCGAGTGGGAAATGGAAGAAGCTCCTTTGCATGTCCTGA
Transcript >Agabi119p4|737400
ATGACTTCACCAAGTGCTCGCGTACATTGGCTTGATGGATCCCCTCCAGCTTTTACCCCTTCTGGGACGGCCTTT
GGTATTCCCTGGTCTCAAGGGGAAATTGATCGCACAACGCCACTGAAGATTCGATCGTCTTCTACAAGTCTCCCT
TTGCAGAGTTGGCCACTCGCATACTGGCCGGATGGTACTCTGAAATGGTCTGGGCATGCGCTTCCGGCGAATCTG
GCCACCGACTCGTCAGAGCTAATCGTGTCACCTGGGACTCCGACTGAGCCTGAATCACCCGTCTCGGTAACACAT
GATGGCGATGCTACGATAGTCTCAACAGGACCTTTCTCAGTTCGGTTTAATGCGCCTGGTTCAACGAGTTTAATA
TCTTCGATCGTTTTGAATGGTAAAACTCTCGCTCAAAATGCAACTCTCGTCCTCCATGTCCAGAATGCCCCGGAT
CCTGATCTAACACTCGTTCGAACTGGTATCACACAATTTCCTGATGTCCAGAGTATGAATGGTAAGATCGATACT
GTTCAAGTTGAACAAGAAGGCCCCGTCCGCGCTGTAATCAAAATGACGGGTAAATACACAGCGACAACGGGTGGT
GAACATGCCGATTTTCTTCCGTTCACTCTACGCTTTTATATCTCTTCTGGGGCTACAACGCTCCGAATGGTTCAC
TTTTTCATATACGATGGTGACCAGACCAAAGATTTCATCAAGGGCCTTGGCCTGACTTTTTCGACACCAATGTCG
GACCAACTCCATGACAGACACATTCGGTTCCTGTCCTCCCCATTTCCCAATGCATCTGCATCCAAGCCAGACGCG
TCTGATTCAGGAGTAGCCGGTGTTTGGGGTGAAGCGGCACGTGTTGTTTCCGGGCTTCGTCGGGACGCCACCGCT
CCGGTTCTTAATGCTCAATTCAATGGGACGCCTACCCCACCTCTCAATACGTGGCCATCGAATGTAACTGCCGGG
CTTGATGACTTGCCGGCATGGTCAGACTATTCGCTTGACCAACTCTCTCCGTCATATTTCTCCATCAGTAAACGT
ACAAACGCAAGTACCAAGGCGAACTGGGTTAGTCATGCTGGTCATGGAACGCGAGCAGCAGGATTGGGCTATGTA
GGAGGCGCTACAAATGGAGGAGTGGTTTTTGGATTGCGAGATTTCTGGCAAGGTGCCCCTAGGAGTTTACATATT
AGAAATGCGGCGGAGGATGTAGCAAATGTGACACTTTGGGCATGGAGTCCTCAGGCTCCAGCCATGGATATGCGA
CATTATGATACAGTTCCTCACGGGCTTGACCTCACATATGAGGACGTGGGTAATCCGGACCCCACTCCTATCGGA
ATCGGAAGGTCATACGAAATAACTTTGCAACTCTTCTCAGCCACACCAAGCCGATCCGATTTAGCAAAACTGGCG
GATGTACATACCCGCGTCCCTCAGCTTGTTTCCACACCTAAGTTTTATGCGTCCAAGAAATTGTTTGGTGGTCGA
TGGGATTTACCTGATACAACGCGAAGTGGCGCTGCGATAATTGAGAAACAGAAAAGCGATCTTTTGGATTTCTAC
ATCAAGGATATTGACCAGAGACAGTTCTACGGATTCTGGAATTATGGTGATGTCATGCATACTTACGATCAAACG
AGGCATGAATGGCGATATGATATTGGCGGATTTGCTTGGGACAATGGTGAACTCGGAACAGATCTGTGGCTTTGG
CTCTCCTTCCTCCGTACAGGCCGTGCAGACGTCTTCCGCATCGCATCGGCTTTGACACGCCATCTTTCTGAGACG
GATACGCATCACACTGGTCCGTTGGCTGGACTTGGCTCAAGGCACAACGTTAGTCATTGGGGAGATGGTGCCAAA
GAGGCACGAGTTTCTGGAAGCTGGTTGAGAAGACCATTTTATTTTATCACGACGGACGAGCTCATGGGAGATATG
ATGGATCTGACGCTTCAAGCTGACCAGACGATCATGGAATGGGATCCACTACGAAAGGTTTTACCACCTCCACCC
CCTGAAGGACCTGGTCGACTCAGGATTGGACCTGACTGGAATGCTTTAGCCGGTAATTGGTTTACCAAGTGGGAG
AGAACTATGGACAACCAGTGGCTTGAGAGGATGAAGATCGGCATGAGAGATATAGGAAGCTTCAAGTTCGGATTA
TTCACGGGAGATGGATCAGCTGTGGGTTGGAATGCTGATACAGCACACTTGGTAGATGAGGGCGGGGAAGGCAAA
AGCTCGTATCACCTCATGATGCTTTTTGGAGGCGGTGAATTCCTGATGGAAGCCATGGATCTGACCGTTATTCGC
GATGATGTACCGGAGTTCGATGCTGCCTGGTTGGATTTCTGCCGTCTCTTTAATGGTACGAACGATGAGAAAATC
GCGAGGTATGGGAAAGCATTTTCAAGTGGAGGTTTTCAGCAGCTTTATGCTAAGCTGCAAGCTTATGTGGGTCAA
CGCTTGAATCAGACTGAGCTCCAAGAACGGGCTTGGGACTTTTTGAATGGGAATACCACCGGTGTATATCCACCT
GCTGTCTCAGTCGGCGGAACAGATGTGCTGAACCCTATCATGGAGATTGTGAATTTAGCTACCAACGATGCTGCC
CATCTCTCTCTTTCTCAATACGCGGTTCTTGCAATTGCGCCAGACTTAGCCCCAAATGAGGTGTGGGACTCACAA
GAAGGGGACGAGGCGACCATAGTCAATTTTGATAAAAATATTCTCAAGCTTCCTGGGGACTCGGACTTACCGAAA
CAGAGACAGAGGTCGAGTGGGAAATGGAAGAAGCTCCTTTGCATGTCCTGA
Gene >Agabi119p4|737400
ATGACTTCACCAAGTGCTCGCGTACATTGGCTTGATGGATCCCCTCCAGCTTTTACCCCTTCTGGGACGGCCTTT
GGTATTCCCTGGTCTCAAGGGGAAATTGATCGCACAACGCCACTGAAGATTCGATCGTCTTCTACAAGTCTCCCT
TTGCAGAGTTGGCCACTCGCATAGTAAGAACCCCCTTAAACTCTCATGTTTGCTGAAGCTAAGGTGTATCTCATC
CAGCTGGCCGGATGGTACTCTGAAATGGTCTGGGCATGCGCTTCCGGCGAATCTGGCCACCGACTCGTCAGAGCT
AATCGTGTCACCTGGGACTCCGACTGAGCCTGAATCACCCGTCTCGGTAACACATGATGGCGATGCTACGATAGT
CTCAACAGGACCTTTCTCAGGTGATCATCTTACTTCATGTTCTTTGTTCATTAGTGGAGAATTGATTTTGATTCT
GATAGTTCGGTTTAATGCGCCTGGTTCAACGAGTTTAATATCTTCGATCGTTTTGAATGGTAAAACTCTCGCTCA
AAATGCAACTCTCGTCCTCCATGTCCAGAATGCCCCGGATCCTGATCTAACACTCGTTCGAACTGGTATCACACA
ATTTCCTGATGTCCAGAGTATGAATGGTAAGATCGATACTGTTCAAGTTGAACAAGAAGGCCCCGTCCGCGCTGT
AATCAAAGTGTGTTGACACTCACAAACTGCTACTATAGATTTATCTGACGAAGTAGTAACAGATGACGGGTAAAT
ACACAGCGACAACGGGTGGTGAACATGCCGATTTTCTTCCGTTCACTCTACGCTTTTATATCTCTTCTGGGGCTA
CAACGCTCCGAATGGTTCACTTTTTCATATACGATGGTGACCAGACCAAAGATTTCATCAAGGGCCTTGGCCTGA
CTTTTTCGACACCAATGTCGGACCAACTCCATGACAGACACATTCGGTTCCTGTCCTCCCCATTTCCCAATGCAT
CTGCATCCAAGCCAGACGCGTCTGATTCAGGAGTAGCCGGTGCGTAAGATCGTTATGGGCTCGATACAATCTTTG
AGTAATTGAGATTTAAACTTTTAAGGTGTTTGGGGTGAAGCGGCACGTGTTGTTTCCGGGCTTCGTCGGGACGCC
ACCGCTCCGGTTCTTAATGCTCAATTCAATGGGACGCCTACCCCACCTCTCAATACGTGGCCATCGAATGTAACT
GCCGGGCTTGATGACTTGCCGGTATGAGGAGAGTATTCACCTTGCTGGCTCTTGAGCTTATTACCGTTGGCAGGC
ATGGTCAGACTATTCGCTTGACCAACTCTCTCCGTCATATTTCTCCATCAGTAAACGTACAAACGCAAGTACCAA
GGCGAACTGGGTTAGTCATGCTGGTCATGGAACGCGAGCAGCAGGATTGGGCTATGTAGGAGGCGCTACAAATGG
AGGAGTGGTTTTTGGATTGCGAGGTGAGAGAGAGAGCGCGCACCTGCCTTCTTAGACTGAATCCGATGGCGTATG
TCAGATTTCTGGCAAGGTGCCCCTAGGAGTTTACATATTAGAAATGCGGCGGAGGATGTAGCAAATGTGACACTT
TGGGCATGGAGTCCTCAGGTACGTATGGTTCATTTTTTCCGTTGGTATCCTTCCTCAGGATTGCTCAGGCTCCAG
CCATGGATATGCGACATTATGATACAGTTCCTCACGGGGTGAGCTACATCTCTCCAGGATTATTTCACTTTGTAA
ATGCGGTTTTAGCTTGACCTCACATATGAGGACGTGGGTAATCCGGACCCCACTCCTATCGGAATCGGAAGGTCA
TACGAAATAACTTTGCAACTCTTCTCAGCCACACCAAGCCGATCCGATTTAGCAAAACTGGCGGATGTACATGTA
TATTTCGCTCAATTTTTGGTCTGAAATTTTACTAACTTTTATAGACCCGCGTCCCTCAGCTTGTTTCCACACCTA
AGTTTTATGCGTCCAAGAAATTGTTTGGTGGTCGATGGGATTTACCTGATACAACGCGAAGTGGCGCTGCGATAA
TTGAGAAACAGAAAAGCGATCTTTTGGATTTCTACATCAAGGTAAGGATATGCATTTCGTGTTCATTAAAAGCAA
TTAAAACATCTTTCGACAGGATATTGACCAGAGACAGTTCTACGGATTCTGGAATTATGGTGATGTCATGCATAC
TTACGATCAAACGAGGCATGAATGGCGATATGATATTGGCGGATTTGCTTGGGACAATGGTGAACTCGGTAAGTG
TACCATTCTCTCGACTACCGTATCTATTGACTCAGTCGTTCCTTAAGGAACAGATCTGTGGCTTTGGCTCTCCTT
CCTCCGTACAGGCCGTGCAGACGTCTTCCGCATCGCATCGGCTTTGACACGCCATCTTTCTGAGACGGATACGCA
TCACACTGGTCCGTTGGCTGGACTTGGCTCAAGGCACAACGTTAGTCATTGGGGAGATGGTGCCAAAGAGGCACG
AGTTTCTGGAAGCTGGTTGAGAAGACCATTTTATTTTATCACGAGTACGTTACCAGAATAATGTTCAAGATAAGA
GGCTGAGTGGATTCGTTAGCGGACGAGCTCATGGGAGATATGATGGATCTGACGCTTCAAGCTGACCAGACGATC
ATGGAATGGGATCCACTACGAAAGGTTTTACCACCTCCACCCCCTGAAGGACCTGGTCGACTCAGGATTGGACCT
GACTGGAATGCTTTAGCCGGTAATTGGTTTACCAAGTGGGAGAGAACTGTAAGTATTTCGTGACCGTTTACATCT
CTGTGTTGACTCAAGCATGCCGAAGATGGACAACCAGTGGCTTGAGAGGATGAAGATCGGCATGGTGAGGTTCTA
TAAACGGGACGATTTTTCCATCGCTTAATTTGGTCGCAGAGAGATATAGGAAGCTTCAAGTTCGGATTATTCACG
GGAGATGGATCAGCTGTGGGTTGGAATGCTGATACAGCACACTTGGTAGATGAGGGCGGGGAAGGCAAAAGCTCG
TAAGTTCTAACTGAACAAGTCATCGCCATTGCAACTTGAATCAACGAAACTTAAGGTATCACCTCATGATGCTTT
TTGGAGGCGGTGAATTCCTGATGGAAGCCATGGATCTGACCGTTATTCGCGATGATGTACCGGAGTTCGATGCTG
CCTGGTTGGATTTCTGCCGTCTCTTTAATGGTACGAACGATGAGTAAGCGCCGGTGATTTTTTCGGATCAGTGTA
CAAGAACTAATGTTCGGATTGACAGGAAAATCGCGAGGTATGGGAAAGCATTTTCAAGTGGAGGTTTTCAGCAGG
TGCTGTGCTGTTTTTATTCGCGTGCATAGTAGTTTCTCAGACATTTTTTCTATAGCTTTATGCTAAGCTGCAAGC
TTATGTGGGTCAACGCTTGAATCAGACTGAGCTCCAAGAACGGGCTTGGGACTTTTTGAATGGGAATACCACCGG
TGTATATCCACCTGCTGTCTCAGTCGGCGGAACAGATGTGCTGAACCCTATCATGGAGGTAAGAAATCCTCGCAT
GAATGGTTTACCTGGCTGACTGCGAGGTGTTTCCGAAAATTAAGATTGTGAATTTAGCTACCAACGATGCTGCCC
ATCTCTCTCTTTCTCAATACGCGGTTCTTGCAATTGCGCCAGACTTAGCCCCAAATGAGGTGTGGGACTCACAAG
AAGGGGACGAGGCGACCATAGTCAATTTTGATAAAAATATTCTCAAGCTTCCTGGGGACTCGGACTTACCGAAAC
AGAGACAGAGGTCGAGTGGGAAATGGAAGAAGCTCCTTTGCATGTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail