Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|737350
Gene name
Locationscaffold_10:1101537..1103175
Strand-
Gene length (bp)1638
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00840 Glyco_hydro_7 Glycosyl hydrolase family 7 2.4E-205 21 450
PF00734 CBM_1 Fungal cellulose binding domain 7.0E-14 475 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QPG2|CBHA_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|Q00328|GUX1_COCCA Exoglucanase 1 OS=Cochliobolus carbonum GN=CEL1 PE=3 SV=1 1 450 0.0E+00
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 4 506 0.0E+00
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 4 506 0.0E+00
sp|P15828|GUX1_HUMGT Exoglucanase 1 OS=Humicola grisea var. thermoidea GN=CBH-1 PE=1 SV=2 27 506 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QPG2|CBHA_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|Q00328|GUX1_COCCA Exoglucanase 1 OS=Cochliobolus carbonum GN=CEL1 PE=3 SV=1 1 450 0.0E+00
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 4 506 0.0E+00
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 4 506 0.0E+00
sp|P15828|GUX1_HUMGT Exoglucanase 1 OS=Humicola grisea var. thermoidea GN=CBH-1 PE=1 SV=2 27 506 0.0E+00
sp|P46238|GUXC_FUSOX Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 19 505 0.0E+00
sp|P38676|GUX1B_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 4 505 0.0E+00
sp|Q9UVS9|CBHA_ASPNG 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus niger GN=cbhA PE=2 SV=1 1 451 0.0E+00
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 19 505 0.0E+00
sp|A1DMA5|CBHA_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 1 506 0.0E+00
sp|Q0CRF7|CBHA_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhA PE=3 SV=1 1 453 0.0E+00
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 4 506 0.0E+00
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 4 506 0.0E+00
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 18 506 0.0E+00
sp|Q00548|GUX1_CRYPA Exoglucanase 1 OS=Cryphonectria parasitica GN=CBH-1 PE=3 SV=1 1 450 0.0E+00
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 1 506 0.0E+00
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 4 506 0.0E+00
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 1 506 0.0E+00
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 1 506 0.0E+00
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 1 506 0.0E+00
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 1 506 0.0E+00
sp|Q8NK02|CBHB_EMENI 1,4-beta-D-glucan cellobiohydrolase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhB PE=3 SV=1 4 506 0.0E+00
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 19 506 0.0E+00
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 4 506 0.0E+00
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 4 506 0.0E+00
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 8 506 0.0E+00
sp|A1CE97|CBHA_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhA PE=3 SV=1 1 452 0.0E+00
sp|Q5B2Q4|CBHA_EMENI Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhA PE=2 SV=1 1 450 0.0E+00
sp|Q4WNA2|CBHA_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhA PE=3 SV=1 1 450 0.0E+00
sp|B0Y793|CBHA_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhA PE=3 SV=1 1 450 0.0E+00
sp|Q2UBM3|CBHA_ASPOR Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|B8N7G5|CBHA_ASPFN Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cbhA PE=3 SV=1 1 451 0.0E+00
sp|A1D932|CELB_NEOFI Probable endo-beta-1,4-glucanase celB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=celB PE=3 SV=1 8 452 7.0E-118
sp|Q4WAJ6|CELB_ASPFU Probable endo-beta-1,4-glucanase celB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=celB PE=3 SV=1 7 451 6.0E-117
sp|B0YBX0|CELB_ASPFC Probable endo-beta-1,4-glucanase celB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=celB PE=3 SV=1 7 451 3.0E-116
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 19 506 5.0E-115
sp|Q2TX26|CELB_ASPOR Endo-beta-1,4-glucanase celB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=celB PE=1 SV=1 10 452 1.0E-113
sp|B8NW70|CELB_ASPFN Probable endo-beta-1,4-glucanase celB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=celB PE=3 SV=1 10 452 1.0E-113
sp|A1CG87|CELB_ASPCL Probable endo-beta-1,4-glucanase celB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=celB PE=3 SV=1 19 450 3.0E-112
sp|Q0CC84|CELB_ASPTN Probable endo-beta-1,4-glucanase celB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=celB PE=3 SV=1 18 450 3.0E-107
sp|Q12714|GUN1_TRILO Endoglucanase EG-1 OS=Trichoderma longibrachiatum GN=egl1 PE=3 SV=1 5 506 2.0E-102
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 10 506 6.0E-99
sp|Q5B7R2|CELB_EMENI Endo-beta-1,4-glucanase celB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=celB PE=1 SV=1 19 450 2.0E-94
sp|G4NK46|CEL7B_MAGO7 Endoglucanase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=egl1 PE=1 SV=1 1 451 1.0E-88
sp|Q12622|GUN1_HUMGT Endoglucanase EG-1 OS=Humicola grisea var. thermoidea GN=EG-1 PE=3 SV=1 18 451 3.0E-87
sp|P56680|GUN1_HUMIN Endoglucanase 1 OS=Humicola insolens GN=CEL7B PE=1 SV=1 27 451 5.0E-86
sp|P46237|GUNC_FUSOX Endoglucanase type C OS=Fusarium oxysporum PE=1 SV=1 4 449 3.0E-78
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 462 506 9.0E-11
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 467 506 1.0E-09
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 472 506 6.0E-09
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 460 506 5.0E-08
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 475 506 9.0E-08
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 474 506 1.0E-07
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 472 506 1.0E-07
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 472 506 1.0E-07
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 472 506 2.0E-07
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 467 506 2.0E-07
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 475 506 4.0E-07
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 475 505 6.0E-07
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 467 506 6.0E-07
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 472 505 1.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 475 506 2.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 472 506 2.0E-06
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 474 506 2.0E-06
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 474 506 2.0E-06
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 461 505 3.0E-06
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 473 506 4.0E-06
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 461 506 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030248 cellulose binding Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0030247 polysaccharide binding No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0030246 carbohydrate binding No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|737350
MFPRSILLALSLTAVALGQQVGTNMAENHPSLTWQRCTSSGCQNVNGKVVLDANWRWTHRVNDFTNCYTGNEWDT
SICPDGATCAQNCALDGADYAGTYGVTSSGTALTLKFVTESQQKNIGSRLYLMADDSNYEIFNLLNKEFTFDVDV
SKLPCGLNGALYFSEMAADGGMSSTNTAGAKYGTGYCDSQCPRDIKFIDGEANSEGWEGSPNDVNAGTGNFGACC
SEMDIWEANSISSAYTPHPCREPGLQRCEGNTCSVNDRYATECDPDGCDFNSFRMGDKSFYGPGMTVDTNSPITV
VTQFITDNGSDNGNLQEIRRIYVQNGQVIQNSNVNIPGIDSGNSISAEFCDQAKEAFGDERSFQDKGGLSGMGSA
LDRGMVLVLSIWDDHAVNMLWLDSDYPLDASPSQPGVSRGTCSRDSGKPEDVEANAGGVQVVYSNIKFGDINSTF
NNNGGGGGNPSPTTTRPNSPAQTMWGQCGGQGWTGPTTCQSPATCHVINDFYSQCF*
Coding >Agabi119p4|737350
ATGTTCCCGAGATCCATTCTCCTCGCCCTCTCCCTCACTGCTGTTGCCTTGGGCCAGCAAGTCGGTACCAACATG
GCCGAAAACCACCCATCGCTCACTTGGCAAAGGTGCACCAGCAGCGGTTGCCAGAACGTGAATGGCAAAGTCGTC
CTCGACGCCAACTGGCGTTGGACTCACCGTGTTAACGACTTCACCAACTGCTACACTGGTAACGAATGGGACACT
TCTATTTGTCCCGACGGCGCAACTTGTGCCCAGAACTGCGCGCTCGATGGTGCTGACTACGCAGGCACATACGGT
GTCACCTCCTCCGGCACCGCTCTTACTCTGAAATTCGTCACTGAGAGTCAGCAGAAGAACATTGGTTCTCGTCTC
TATCTCATGGCTGATGATTCCAACTATGAGATCTTCAACCTCTTGAATAAAGAGTTCACTTTCGACGTCGATGTC
TCCAAACTTCCTTGCGGTCTTAACGGTGCCCTTTACTTCTCGGAGATGGCTGCAGATGGTGGCATGTCGTCGACC
AATACAGCTGGTGCCAAGTACGGTACTGGTTATTGTGACTCGCAATGCCCTCGTGACATCAAGTTTATCGACGGA
GAGGCCAACAGCGAGGGCTGGGAAGGCTCCCCGAACGACGTCAACGCTGGAACTGGCAACTTTGGTGCCTGCTGC
AGTGAAATGGATATCTGGGAGGCCAACTCTATCTCTTCCGCCTACACTCCCCATCCCTGTAGGGAACCCGGACTC
CAGCGTTGCGAGGGTAACACTTGCTCAGTCAACGATCGCTATGCGACTGAGTGTGACCCCGACGGTTGTGATTTC
AACTCCTTCCGTATGGGAGACAAGTCGTTCTACGGCCCCGGCATGACAGTCGACACCAACAGTCCCATCACCGTC
GTTACTCAGTTTATCACTGATAATGGCTCCGACAACGGTAATCTCCAGGAGATCCGCCGCATCTATGTCCAGAAC
GGCCAGGTCATCCAGAACTCCAATGTCAACATTCCCGGAATCGACTCCGGCAACTCCATTTCCGCAGAATTCTGT
GACCAGGCTAAGGAAGCCTTCGGTGATGAGCGATCATTCCAAGATAAGGGTGGATTGTCGGGTATGGGTTCTGCG
TTGGACCGCGGAATGGTTCTCGTCCTTTCCATCTGGGATGACCATGCCGTTAACATGTTGTGGCTCGACTCTGAC
TACCCCCTTGACGCCTCCCCAAGTCAACCAGGTGTTTCCCGTGGTACCTGCTCTAGGGACTCTGGTAAACCCGAG
GATGTTGAGGCTAACGCTGGCGGCGTCCAAGTCGTCTACTCCAACATCAAGTTCGGTGACATCAACTCCACTTTC
AACAACAACGGTGGTGGCGGTGGCAACCCTAGCCCAACTACCACTCGCCCCAACTCGCCCGCTCAAACCATGTGG
GGTCAATGTGGTGGTCAAGGCTGGACTGGCCCGACTACTTGCCAATCTCCCGCTACTTGCCACGTCATCAACGAC
TTCTATAGCCAATGTTTCTAA
Transcript >Agabi119p4|737350
ATGTTCCCGAGATCCATTCTCCTCGCCCTCTCCCTCACTGCTGTTGCCTTGGGCCAGCAAGTCGGTACCAACATG
GCCGAAAACCACCCATCGCTCACTTGGCAAAGGTGCACCAGCAGCGGTTGCCAGAACGTGAATGGCAAAGTCGTC
CTCGACGCCAACTGGCGTTGGACTCACCGTGTTAACGACTTCACCAACTGCTACACTGGTAACGAATGGGACACT
TCTATTTGTCCCGACGGCGCAACTTGTGCCCAGAACTGCGCGCTCGATGGTGCTGACTACGCAGGCACATACGGT
GTCACCTCCTCCGGCACCGCTCTTACTCTGAAATTCGTCACTGAGAGTCAGCAGAAGAACATTGGTTCTCGTCTC
TATCTCATGGCTGATGATTCCAACTATGAGATCTTCAACCTCTTGAATAAAGAGTTCACTTTCGACGTCGATGTC
TCCAAACTTCCTTGCGGTCTTAACGGTGCCCTTTACTTCTCGGAGATGGCTGCAGATGGTGGCATGTCGTCGACC
AATACAGCTGGTGCCAAGTACGGTACTGGTTATTGTGACTCGCAATGCCCTCGTGACATCAAGTTTATCGACGGA
GAGGCCAACAGCGAGGGCTGGGAAGGCTCCCCGAACGACGTCAACGCTGGAACTGGCAACTTTGGTGCCTGCTGC
AGTGAAATGGATATCTGGGAGGCCAACTCTATCTCTTCCGCCTACACTCCCCATCCCTGTAGGGAACCCGGACTC
CAGCGTTGCGAGGGTAACACTTGCTCAGTCAACGATCGCTATGCGACTGAGTGTGACCCCGACGGTTGTGATTTC
AACTCCTTCCGTATGGGAGACAAGTCGTTCTACGGCCCCGGCATGACAGTCGACACCAACAGTCCCATCACCGTC
GTTACTCAGTTTATCACTGATAATGGCTCCGACAACGGTAATCTCCAGGAGATCCGCCGCATCTATGTCCAGAAC
GGCCAGGTCATCCAGAACTCCAATGTCAACATTCCCGGAATCGACTCCGGCAACTCCATTTCCGCAGAATTCTGT
GACCAGGCTAAGGAAGCCTTCGGTGATGAGCGATCATTCCAAGATAAGGGTGGATTGTCGGGTATGGGTTCTGCG
TTGGACCGCGGAATGGTTCTCGTCCTTTCCATCTGGGATGACCATGCCGTTAACATGTTGTGGCTCGACTCTGAC
TACCCCCTTGACGCCTCCCCAAGTCAACCAGGTGTTTCCCGTGGTACCTGCTCTAGGGACTCTGGTAAACCCGAG
GATGTTGAGGCTAACGCTGGCGGCGTCCAAGTCGTCTACTCCAACATCAAGTTCGGTGACATCAACTCCACTTTC
AACAACAACGGTGGTGGCGGTGGCAACCCTAGCCCAACTACCACTCGCCCCAACTCGCCCGCTCAAACCATGTGG
GGTCAATGTGGTGGTCAAGGCTGGACTGGCCCGACTACTTGCCAATCTCCCGCTACTTGCCACGTCATCAACGAC
TTCTATAGCCAATGTTTCTAA
Gene >Agabi119p4|737350
ATGTTCCCGAGATCCATTCTCCTCGCCCTCTCCCTCACTGCTGTTGCCTTGGGCCAGCAAGTCGGTACCAACATG
GCCGAAAACCACCCATCGCTCACTTGGCAAAGGTGCACCAGCAGCGGTTGCCAGAACGTGAATGGCAAAGTCGTC
CTCGACGCCAACTGGCGTTGGACTCACCGTGTTAACGACTTCACCAACTGCTACACTGGTAACGAATGGGACACT
TCTATTTGTCCCGACGGCGCAACTTGTGCCCAGAACTGCGCGCTCGATGGTGCTGACTACGCAGGCACATACGGT
GTCACCTCCTCCGGCACCGCTCTTACTCTGAAATTCGTCACTGAGAGTCAGCAGAAGAACATTGGTTCTCGTCTC
TATCTCATGGCTGATGATTCCAACTATGAGATCTTCAACCTCTTGAATAAAGAGTTCACTTTCGACGTCGATGTC
TCCAAACTTCCTTGCGGTCTTAACGGTGCCCTTTACTTCTCGGAGATGGCTGCAGATGGTGGCATGTCGTCGACC
AATACAGCTGGTGCCAAGTACGGTACTGGTTATTGTGACTCGCAATGCCCTCGTGACATCAAGTTTATCGACGGA
GAGGTAAGCATTGAAATATTCTCGCTGAGAGTAGCTCAGCTAATAATATATTGATTAGGCCAACAGCGAGGGCTG
GGAAGGCTCCCCGAACGACGTCAACGCTGGAACTGGCAACTTTGGTGCCTGCTGCAGTGAAATGGATATCTGGGA
GGCCAACTCTATCTCTTCCGCCTACACTCCCCATCCCTGTAGGGAACCCGGACTCCAGCGTTGCGAGGGTAACAC
TTGCTCAGTCAACGATCGCTATGCGACTGAGTGTGACCCCGACGGTTGTGATTTCAACTCCTTCCGTATGGGAGA
CAAGTCGTTCTACGGCCCCGGCATGACAGTCGACACCAACAGTCCCATCACCGTCGTTACTCAGTTTATCACTGA
TAATGGCTCCGACAACGGTAATCTCCAGGAGATCCGCCGCATCTATGTCCAGAACGGCCAGGTCATCCAGAACTC
CAATGTCAACATTCCCGGAATCGACTCCGGCAACTCCATTTCCGCAGAATTCTGTGACCAGGCTAAGGAAGCCTT
CGGTGATGAGCGATCATTCCAAGATAAGGGTGGATTGTCGGGTATGGGTTCTGCGTTGGACCGCGGAATGGTTCT
CGTCCTTTCCATCTGGGATGACCATGCCGTTAACATGTTGTGGCTCGACTCTGACTACCCCCTTGACGCCTCCCC
AAGTCAACCAGGTGTTTCCCGTGGTACCTGCTCTAGGGACTCTGGTAAACCCGAGGATGTTGAGGCTAACGCTGG
CGGCGTCCAAGTCGTCTACTCCAACATCAAGTTCGGTGACATCAACTCCACTTTCAACAACAACGGTGGTGGCGG
TGGCAACCCTAGCCCAACTACCACTCGCCCCAACTCGCCCGCTCAAACCATGTGGGGTCAATGGTGAGTTTTGGC
TTTAGACTTTTGTAATCAAATTTCGAGAGCTGACTCGTAACCTTTTCTAGTGGTGGTCAAGGCTGGACTGGCCCG
ACTACTTGCCAATCTCCCGCTACTTGCCACGTCATCAACGACTTCTATAGCCAATGTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail