Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|731000
Gene name
Locationscaffold_10:648023..649277
Strand-
Gene length (bp)1254
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|U6A629|ABFA_PENCN Alpha-L-arabinofuranosidase A OS=Penicillium canescens GN=abfA PE=1 SV=1 27 305 1.0E-74
sp|Q2U790|ABFA_ASPOR Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abfA PE=3 SV=2 27 305 6.0E-68
sp|B8NKA3|ABFA_ASPFN Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abfA PE=3 SV=2 27 305 6.0E-68
sp|Q0CTV2|ABFA_ASPTN Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abfA PE=3 SV=1 27 305 5.0E-67
sp|Q96X54|ABFA_ASPAW Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori GN=abfA PE=1 SV=1 27 305 1.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|U6A629|ABFA_PENCN Alpha-L-arabinofuranosidase A OS=Penicillium canescens GN=abfA PE=1 SV=1 27 305 1.0E-74
sp|Q2U790|ABFA_ASPOR Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abfA PE=3 SV=2 27 305 6.0E-68
sp|B8NKA3|ABFA_ASPFN Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abfA PE=3 SV=2 27 305 6.0E-68
sp|Q0CTV2|ABFA_ASPTN Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abfA PE=3 SV=1 27 305 5.0E-67
sp|Q96X54|ABFA_ASPAW Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori GN=abfA PE=1 SV=1 27 305 1.0E-57
sp|Q8NK90|ABFA_ASPKW Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=abfA PE=1 SV=2 27 305 1.0E-57
sp|P42254|ABFA_ASPNG Alpha-L-arabinofuranosidase A OS=Aspergillus niger GN=abfA PE=1 SV=1 27 305 1.0E-56
sp|A2Q7E0|ABFA_ASPNC Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abfA PE=3 SV=1 27 305 1.0E-56
sp|Q5BA89|ABFA_EMENI Probable alpha-L-arabinofuranosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abfA PE=3 SV=1 62 308 6.0E-42
sp|Q9SG80|ASD1_ARATH Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana GN=ASD1 PE=1 SV=1 27 304 9.0E-24
sp|Q8VZR2|ASD2_ARATH Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana GN=ASD2 PE=2 SV=1 82 304 3.0E-21
sp|P82593|EABF_STRCX Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis PE=1 SV=1 27 276 2.0E-19
sp|A3DIH0|IABF_CLOTH Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=Cthe_2548 PE=1 SV=1 189 279 1.0E-06
sp|A2QQ94|ABFC_ASPNC Probable alpha-L-arabinofuranosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abfC PE=3 SV=1 197 275 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|731000
MSVLLKSVSAYSIVVMVVSMPSEASVVIQNRAFQLVSPGSGSALNAWQAVNGASLRVIQESVPVSSALPNALQVD
FPTGRSGGVGFANTGFGGIKVTSGTTYTGSFFYRFPSSSGFQGSATVSLQSSSGSTLGSTTVNLSGSQTSWRKLT
FSIRASSTPGNTNNRFVVTLDGRSAGGQSIHFTMLSLFPPTFKNRPNGMRIDIATTLAEMGPSFWRFPGGNNLEG
QTVARRWQWNATVGPLETRPGRQGDWGYVNSDGLGILEYLHWCEDLNVEPIMGVWAGFALGGTSVPENQLQPFID
QAADQASIYAD*
Coding >Agabi119p4|731000
ATGAGCGTTTTACTCAAATCAGTCTCTGCTTATAGCATAGTGGTGATGGTGGTCTCTATGCCGAGTGAAGCATCT
GTAGTAATTCAAAACAGAGCATTCCAGCTAGTCAGTCCTGGATCCGGCTCAGCTCTAAATGCATGGCAAGCTGTC
AATGGAGCGAGTCTGAGGGTCATCCAAGAGTCCGTTCCGGTATCTTCTGCTCTACCCAACGCCCTTCAAGTTGAC
TTTCCAACTGGACGTTCTGGGGGAGTTGGATTCGCTAACACGGGCTTTGGTGGCATCAAGGTTACTTCTGGAACG
ACTTACACTGGTTCTTTCTTTTATCGTTTCCCCAGCTCTTCCGGATTCCAAGGTAGCGCCACTGTGTCTTTGCAG
TCATCTTCTGGGTCAACGCTCGGCAGCACCACTGTGAACTTGTCTGGTTCTCAGACGTCCTGGCGCAAATTGACG
TTCAGTATCCGCGCGTCCAGTACTCCCGGAAATACAAATAATCGTTTCGTCGTTACGTTAGATGGTAGGAGCGCC
GGTGGTCAAAGCATCCATTTCACAATGTTGTCATTGTTCCCACCGACGTTCAAAAATCGTCCGAATGGCATGAGA
ATTGATATTGCGACGACATTGGCGGAAATGGGACCGTCGTTTTGGAGGTTCCCTGGAGGTAATAACTTGGAGGGT
CAGACGGTCGCTAGGAGGTGGCAGTGGAATGCTACAGTTGGGCCTTTGGAAACCCGCCCAGGACGACAGGGTGAC
TGGGGCTATGTTAACTCTGATGGTTTGGGTATCCTTGAATACCTTCATTGGTGCGAAGACCTGAATGTGGAGCCG
ATCATGGGTGTTTGGGCAGGGTTTGCACTTGGGGGAACAAGCGTACCTGAAAACCAACTGCAACCTTTTATTGAC
CAGGCAGCCGATCAGGCAAGTATCTACGCTGACTAA
Transcript >Agabi119p4|731000
ATGAGCGTTTTACTCAAATCAGTCTCTGCTTATAGCATAGTGGTGATGGTGGTCTCTATGCCGAGTGAAGCATCT
GTAGTAATTCAAAACAGAGCATTCCAGCTAGTCAGTCCTGGATCCGGCTCAGCTCTAAATGCATGGCAAGCTGTC
AATGGAGCGAGTCTGAGGGTCATCCAAGAGTCCGTTCCGGTATCTTCTGCTCTACCCAACGCCCTTCAAGTTGAC
TTTCCAACTGGACGTTCTGGGGGAGTTGGATTCGCTAACACGGGCTTTGGTGGCATCAAGGTTACTTCTGGAACG
ACTTACACTGGTTCTTTCTTTTATCGTTTCCCCAGCTCTTCCGGATTCCAAGGTAGCGCCACTGTGTCTTTGCAG
TCATCTTCTGGGTCAACGCTCGGCAGCACCACTGTGAACTTGTCTGGTTCTCAGACGTCCTGGCGCAAATTGACG
TTCAGTATCCGCGCGTCCAGTACTCCCGGAAATACAAATAATCGTTTCGTCGTTACGTTAGATGGTAGGAGCGCC
GGTGGTCAAAGCATCCATTTCACAATGTTGTCATTGTTCCCACCGACGTTCAAAAATCGTCCGAATGGCATGAGA
ATTGATATTGCGACGACATTGGCGGAAATGGGACCGTCGTTTTGGAGGTTCCCTGGAGGTAATAACTTGGAGGGT
CAGACGGTCGCTAGGAGGTGGCAGTGGAATGCTACAGTTGGGCCTTTGGAAACCCGCCCAGGACGACAGGGTGAC
TGGGGCTATGTTAACTCTGATGGTTTGGGTATCCTTGAATACCTTCATTGGTGCGAAGACCTGAATGTGGAGCCG
ATCATGGGTGTTTGGGCAGGGTTTGCACTTGGGGGAACAAGCGTACCTGAAAACCAACTGCAACCTTTTATTGAC
CAGGCAGCCGATCAGGCAAGTATCTACGCTGACTAA
Gene >Agabi119p4|731000
ATGAGCGTTTTACTCAAATCAGTCTCTGCTTATAGCATGTGAGTCATTTTATGATCAGCTTAGAATGCTATTCAT
GAGTTTCACTGCAGAGTGGTGATGGTGGTCTCTATGCCGAGTGTAAGAAGCAACGTTAATATAATTGATTTATCT
TGTGAAACTCAGGAAGCATCTGTAGTAATTCAAAACAGAGCATTCCAGCTAGTCAGTCCTGGATCCGGCTCAGCT
CTAAATGCATGGCAAGCTGTCAATGGAGCGAGTCTGAGGGTCATCCAAGAGTCCGTTCCGGTATCTTCTGCTCTA
CCCAACGCCCTTCAAGTTGACTTTCCAACTGGACGTTCTGGGGGAGTTGGATTCGCTAACACGGGCTTTGGTGGT
ATATCTTATCCTTGCCTACTATTCAAGAAACGACTCATCGTAGACTGATCTGCCAGGCATCAAGGTTACTTCTGG
AACGACTTACACTGGTTCTTTCTTTTATCGTTTCCCCAGCTCTTCCGGATTCCAAGGTAGCGCCACTGTGTCTTT
GCAGTCATCTTCTGGGTCAACGCTCGGCAGCACCACTGTGAACTTGTCTGGTTCTCAGACGTCCTGGCGCAAATT
GACGTTCAGTATCCGCGCGTCCAGTACTCCCGGAAATACAAATAATCGTTTCGTCGTTACGTTAGATGGTAGGAG
CGCCGGTGGTCAAAGCATCCATTTCACAATGTTGTCATTGTTCCCACCGACGTTCAAAAATCGTCCGAATGGCAT
GAGAATTGATATTGCGACGACATTGGCGGAAATGGGACCGTCGTTTTGGAGGTTCCCTGGAGGTAATAACTTGGA
GGGTCAGACGGTCGCTAGGAGGTGGCAGTGGAATGCTACAGTTGGGCCTTTGGAAACCCGCCCAGGTGCATATAT
TTCAAGGACTCAACGTCTAGTACGTCACACTGAAAGCCAACTTCTACAGGACGACAGGGTGACTGGGGCTATGTT
AACTCTGAGTGCGTGTCGAATTTGATCAATGATGCTTGATGGTTTATGGTTGTCGTTACTGCAGTGGTTTGGGTA
TCCTTGAATACCTTCATTGGTGCGAAGACCTGAATGTGGAGCCGATCATGGGTGTTTGGGCAGGTAAATTATAAA
AGCGCTATGTCCTACCGATATTCACTTCATGTAACAGGGTTTGCACTTGGGGGAACAAGCGTACCTGAAAACCAA
CTGCAACCTTTTATTGACCAGGCAGCCGATCAGGCAAGTATCTACGCTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail