Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|730950
Gene name
Locationscaffold_10:646430..647915
Strand-
Gene length (bp)1485
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain 7.0E-38 103 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTV2|ABFA_ASPTN Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abfA PE=3 SV=1 4 297 7.0E-48
sp|P42254|ABFA_ASPNG Alpha-L-arabinofuranosidase A OS=Aspergillus niger GN=abfA PE=1 SV=1 4 296 9.0E-48
sp|A2Q7E0|ABFA_ASPNC Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abfA PE=3 SV=1 4 296 2.0E-47
sp|Q8NK90|ABFA_ASPKW Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=abfA PE=1 SV=2 4 296 2.0E-46
sp|Q96X54|ABFA_ASPAW Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori GN=abfA PE=1 SV=1 4 296 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CTV2|ABFA_ASPTN Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=abfA PE=3 SV=1 4 297 7.0E-48
sp|P42254|ABFA_ASPNG Alpha-L-arabinofuranosidase A OS=Aspergillus niger GN=abfA PE=1 SV=1 4 296 9.0E-48
sp|A2Q7E0|ABFA_ASPNC Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abfA PE=3 SV=1 4 296 2.0E-47
sp|Q8NK90|ABFA_ASPKW Alpha-L-arabinofuranosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=abfA PE=1 SV=2 4 296 2.0E-46
sp|Q96X54|ABFA_ASPAW Probable alpha-L-arabinofuranosidase A OS=Aspergillus awamori GN=abfA PE=1 SV=1 4 296 2.0E-46
sp|B8NKA3|ABFA_ASPFN Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abfA PE=3 SV=2 4 296 2.0E-45
sp|Q2U790|ABFA_ASPOR Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abfA PE=3 SV=2 4 296 4.0E-45
sp|Q8VZR2|ASD2_ARATH Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana GN=ASD2 PE=2 SV=1 4 279 2.0E-37
sp|Q5BA89|ABFA_EMENI Probable alpha-L-arabinofuranosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=abfA PE=3 SV=1 2 297 8.0E-32
sp|Q9SG80|ASD1_ARATH Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana GN=ASD1 PE=1 SV=1 4 279 3.0E-29
sp|U6A629|ABFA_PENCN Alpha-L-arabinofuranosidase A OS=Penicillium canescens GN=abfA PE=1 SV=1 4 297 4.0E-29
sp|P82593|EABF_STRCX Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis PE=1 SV=1 4 201 9.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0046556 alpha-L-arabinofuranosidase activity Yes
GO:0046373 L-arabinose metabolic process Yes
GO:0019566 arabinose metabolic process No
GO:0016787 hydrolase activity No
GO:0005996 monosaccharide metabolic process No
GO:0019321 pentose metabolic process No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|730950
MPPGALRASLGHPEPFNLRFVEIGNEDFFGAASYVYRWRNFVNALKNRFPQIHFIATTNVNDPTLSPKPTEYDVH
VYQTPTWFAENSFFYDNFARDGTKYFEGEYAAISTNPNDIFGSPANGRLVFPTMQSAAGEAAFMTGLERNSDIVF
AAAYAPMLGDVNNHQWTPNLVGFDAGNVYRSTSFYVQKLFSLNRGDEYLPSTLPSRTGTLHWSVVRKTSNNQIII
KVSNTGGSTSRLTFNLPFNNVATSGTAQILTGSGTASNTPNNPNLITPQSRNIQTGRSFTFDAPAVSVSVLTFTA
S*
Coding >Agabi119p4|730950
ATGCCTCCAGGTGCTTTGAGAGCGTCCCTCGGACACCCAGAACCATTTAATTTGAGATTCGTAGAAATCGGAAAC
GAGGACTTCTTTGGAGCTGCTTCCTACGTATACCGTTGGCGTAATTTTGTCAATGCTCTCAAGAACCGCTTCCCA
CAAATCCATTTTATTGCCACTACTAACGTCAATGATCCGACTCTCAGCCCGAAACCGACCGAATATGACGTACAC
GTCTACCAAACTCCCACTTGGTTTGCAGAAAATTCATTCTTTTATGATAACTTCGCGAGGGATGGGACCAAGTAT
TTTGAGGGTGAGTATGCGGCCATCTCGACCAACCCTAACGATATCTTCGGGTCCCCTGCCAATGGTCGTCTTGTT
TTCCCAACGATGCAAAGTGCTGCTGGGGAGGCTGCTTTCATGACCGGACTGGAAAGAAATAGTGACATTGTGTTC
GCTGCTGCGTATGCCCCTATGCTCGGTGACGTGAATAATCATCAATGGACCCCGAACTTGGTTGGATTTGATGCA
GGAAATGTCTACCGATCGACAAGTTTCTATGTCCAAAAACTGTTCAGTCTGAACCGCGGTGATGAATATCTCCCG
AGTACCCTTCCCTCTCGTACCGGTACACTTCACTGGAGTGTTGTTCGCAAGACATCGAACAATCAAATTATAATC
AAGGTATCCAATACCGGTGGTAGTACTTCTCGCCTTACTTTCAATCTACCCTTCAACAACGTCGCAACGAGTGGG
ACTGCACAGATTTTGACGGGATCCGGGACTGCTAGTAACACTCCCAACAACCCCAACCTCATCACACCTCAGAGT
AGGAATATCCAGACTGGCCGATCATTCACCTTCGACGCACCAGCAGTTAGTGTGAGCGTTTTGACATTTACGGCT
TCGTGA
Transcript >Agabi119p4|730950
ATGCCTCCAGGTGCTTTGAGAGCGTCCCTCGGACACCCAGAACCATTTAATTTGAGATTCGTAGAAATCGGAAAC
GAGGACTTCTTTGGAGCTGCTTCCTACGTATACCGTTGGCGTAATTTTGTCAATGCTCTCAAGAACCGCTTCCCA
CAAATCCATTTTATTGCCACTACTAACGTCAATGATCCGACTCTCAGCCCGAAACCGACCGAATATGACGTACAC
GTCTACCAAACTCCCACTTGGTTTGCAGAAAATTCATTCTTTTATGATAACTTCGCGAGGGATGGGACCAAGTAT
TTTGAGGGTGAGTATGCGGCCATCTCGACCAACCCTAACGATATCTTCGGGTCCCCTGCCAATGGTCGTCTTGTT
TTCCCAACGATGCAAAGTGCTGCTGGGGAGGCTGCTTTCATGACCGGACTGGAAAGAAATAGTGACATTGTGTTC
GCTGCTGCGTATGCCCCTATGCTCGGTGACGTGAATAATCATCAATGGACCCCGAACTTGGTTGGATTTGATGCA
GGAAATGTCTACCGATCGACAAGTTTCTATGTCCAAAAACTGTTCAGTCTGAACCGCGGTGATGAATATCTCCCG
AGTACCCTTCCCTCTCGTACCGGTACACTTCACTGGAGTGTTGTTCGCAAGACATCGAACAATCAAATTATAATC
AAGGTATCCAATACCGGTGGTAGTACTTCTCGCCTTACTTTCAATCTACCCTTCAACAACGTCGCAACGAGTGGG
ACTGCACAGATTTTGACGGGATCCGGGACTGCTAGTAACACTCCCAACAACCCCAACCTCATCACACCTCAGAGT
AGGAATATCCAGACTGGCCGATCATTCACCTTCGACGCACCAGCAGTTAGTGTGAGCGTTTTGACATTTACGGCT
TCGTGA
Gene >Agabi119p4|730950
ATGCCTCCAGGTGCTTTGAGAGCGTCCCTCGGACACCCAGAACCATTTAATTTGAGATTCGTAGAAATCGGAAAC
GAGGTATGTACATTCAGTTAGCTTGAAAAAAAAGGAAAATGCTCATCAGGTCATAGGACTTCTTTGGAGCTGCTT
CCTACGTATACCGTTGGCGTAATTTTGTCAATGCTCTCAAGAACCGCTTCCCACAAATCCGTGCGCTCTCTTACT
TATTGCATTGGTGTCCTTCTTGACAGCTGAGTCTGCAGATTTTATTGCCACTACTAACGTCAATGATCCGACTCT
CAGCCCGAAACCGACCGAATATGACGTACACGTCTACCAAACTCCCAGTCAGTTCATATCAATCAAAGGGTGTCG
CTGACATTGACAAATTCTGCTATCAAGCTTGGTTTGCAGAAAATTCATTCTTTTATGATAACTTCGCGGTATGTG
CTTGCGTCTAGGAATGTTACTATTTCTGACGATCATCGTTCCCAGAGGGATGGGACCAAGTATTTTGAGGCGAGC
CGAATTCAATGATTTCAAGCTGTAGCACTGATAACCGTATTCCTAGGGTGAGTATGCGGCCATCTCGACCAACCC
TAACGATATCTTCGGGTCCCCTGCCAATGGTCGTCTTGTTTTCCCAACGATGCAAAGTACGTCATTCGATATTAT
ATATGATTTTGGAAACTGATATCAATTACAAGGTGCTGCTGGGGAGGCTGCTTTCATGACCGGACTGGAAAGAAA
TAGTGACATTGTGTAAGTGCGACTCGTGCATTTTGCGATGAATGTCTCTGAAAATTCATGATACTGCTAGGTTCG
CTGCTGCGTATGCCCCTATGCTCGGTGTAAGTACCTAGTGGCGTTCTAAACTCAAATTTTGACGAGAACTTTGCA
GGACGTGAATAATCATCAATGGGTTTGTTTTCACATTCAGGTATTATGTACATGGTCTCTGATACCAACTTTTTA
GACCCCGAACTTGGTTGGATTTGAGTGAGTTGTTGAGCCAATAACCCGACGATATGTTTCTGACAACAAGCAGTG
CAGGAAATGTCTACCGATCGACAAGTTTCTATGTCCAAAAACTGTTCAGTCTGAACCGCGGTGATGAATATCTCC
CGAGTACCCTTCCCTCTCGTACCGGTACACTTCACTGGAGTGTTGTTCGCAAGACATCGAACAATCAAATTATAA
TCAAGGTGAGCCCGTCCACTCAAATTCTTGAACCTGTTGTAAACACCCGTTGCGCAGGTATCCAATACCGGTGGT
AGTACTTCTCGCCTTACTTTCAATCTACCCTTCAACAACGTCGCAACGAGTGGGACTGCACAGATTTTGACGGGA
TCCGGGACTGCTAGTAACACTCCCAACAACCCCAACCTCATCACACCTCAGAGTAGGAATATCCAGACTGGCCGA
TCATTCACCTTCGACGCACCAGCAGTTAGTGTGAGCGTTTTGACATTTACGGCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail